BLASTX nr result
ID: Rehmannia23_contig00010997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00010997 (920 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277031.2| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 emb|CBI39641.3| unnamed protein product [Vitis vinifera] 112 1e-22 ref|XP_006356525.1| PREDICTED: pentatricopeptide repeat-containi... 112 2e-22 ref|XP_003533650.1| PREDICTED: pentatricopeptide repeat-containi... 112 2e-22 ref|XP_006428236.1| hypothetical protein CICLE_v10011195mg [Citr... 111 3e-22 ref|XP_004492592.1| PREDICTED: pentatricopeptide repeat-containi... 111 3e-22 ref|XP_004304914.1| PREDICTED: pentatricopeptide repeat-containi... 111 3e-22 ref|XP_003623648.1| Pentatricopeptide repeat-containing protein ... 111 4e-22 gb|ESW12037.1| hypothetical protein PHAVU_008G079600g [Phaseolus... 110 6e-22 ref|XP_004242257.1| PREDICTED: pentatricopeptide repeat-containi... 110 6e-22 ref|XP_006651327.1| PREDICTED: pentatricopeptide repeat-containi... 110 7e-22 ref|XP_004984577.1| PREDICTED: pentatricopeptide repeat-containi... 110 7e-22 ref|NP_001173399.1| Os03g0317100 [Oryza sativa Japonica Group] g... 110 7e-22 gb|ABF95626.1| pentatricopeptide, putative [Oryza sativa Japonic... 110 7e-22 gb|EAY89771.1| hypothetical protein OsI_11313 [Oryza sativa Indi... 110 1e-21 ref|XP_004157997.1| PREDICTED: pentatricopeptide repeat-containi... 109 2e-21 ref|XP_004144359.1| PREDICTED: pentatricopeptide repeat-containi... 109 2e-21 ref|XP_002319471.1| pentatricopeptide repeat-containing family p... 109 2e-21 gb|EMJ05367.1| hypothetical protein PRUPE_ppa017537mg [Prunus pe... 108 3e-21 ref|XP_003558041.1| PREDICTED: pentatricopeptide repeat-containi... 108 3e-21 >ref|XP_002277031.2| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Vitis vinifera] Length = 703 Score = 112 bits (281), Expect = 1e-22 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EG+PIRVMKNLRVCGDCH+AIKLIA ITGREIILRDANRFHHFKDG CSC+DYW Sbjct: 650 EGMPIRVMKNLRVCGDCHSAIKLIAKITGREIILRDANRFHHFKDGFCSCRDYW 703 >emb|CBI39641.3| unnamed protein product [Vitis vinifera] Length = 251 Score = 112 bits (281), Expect = 1e-22 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EG+PIRVMKNLRVCGDCH+AIKLIA ITGREIILRDANRFHHFKDG CSC+DYW Sbjct: 198 EGMPIRVMKNLRVCGDCHSAIKLIAKITGREIILRDANRFHHFKDGFCSCRDYW 251 >ref|XP_006356525.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Solanum tuberosum] Length = 704 Score = 112 bits (280), Expect = 2e-22 Identities = 48/54 (88%), Positives = 53/54 (98%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EG+PIRVMKNLRVCGDCH+AIKLIA +TGREIILRDANRFHHFKDG+CSCKD+W Sbjct: 651 EGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGVCSCKDFW 704 >ref|XP_003533650.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Glycine max] Length = 711 Score = 112 bits (280), Expect = 2e-22 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EG+PIRVMKNLRVCGDCH+AIKLIA +TGREIILRDANRFHHFKDG CSCKDYW Sbjct: 658 EGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGHCSCKDYW 711 >ref|XP_006428236.1| hypothetical protein CICLE_v10011195mg [Citrus clementina] gi|568854166|ref|XP_006480704.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Citrus sinensis] gi|557530293|gb|ESR41476.1| hypothetical protein CICLE_v10011195mg [Citrus clementina] Length = 703 Score = 111 bits (278), Expect = 3e-22 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EGVPIRVMKNLRVCGDCH+AIKLI+ + GREIILRDANRFHHFKDGLCSC+DYW Sbjct: 650 EGVPIRVMKNLRVCGDCHSAIKLISKVMGREIILRDANRFHHFKDGLCSCRDYW 703 >ref|XP_004492592.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Cicer arietinum] Length = 707 Score = 111 bits (278), Expect = 3e-22 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EG+PIRVMKNLRVCGDCH+AIKLIA +TGREIILRDANRFHHFKDG CSCKD+W Sbjct: 654 EGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGYCSCKDFW 707 >ref|XP_004304914.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 703 Score = 111 bits (278), Expect = 3e-22 Identities = 47/54 (87%), Positives = 53/54 (98%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 +G+PIRVMKNLRVCGDCH+AIKLIA +TGREII+RDANRFHHFKDGLCSC+DYW Sbjct: 650 QGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIIVRDANRFHHFKDGLCSCRDYW 703 >ref|XP_003623648.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498663|gb|AES79866.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 707 Score = 111 bits (277), Expect = 4e-22 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EG+PIRVMKNLRVCGDCH+AIKLIA +TGREIILRDANRFHHFKDG CSCKD+W Sbjct: 654 EGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGSCSCKDFW 707 >gb|ESW12037.1| hypothetical protein PHAVU_008G079600g [Phaseolus vulgaris] Length = 709 Score = 110 bits (276), Expect = 6e-22 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 +G+PIRVMKNLRVCGDCH+AIKLIA +TGREIILRDANRFHHFKDG CSCKDYW Sbjct: 656 KGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGHCSCKDYW 709 >ref|XP_004242257.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Solanum lycopersicum] Length = 1224 Score = 110 bits (276), Expect = 6e-22 Identities = 46/54 (85%), Positives = 53/54 (98%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 +G+PIR+MKNLRVCGDCH+AIKLIA +TGREIILRDANRFHHFKDG+CSCKD+W Sbjct: 1171 QGMPIRIMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGVCSCKDFW 1224 >ref|XP_006651327.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Oryza brachyantha] Length = 733 Score = 110 bits (275), Expect = 7e-22 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EG+PIRVMKNLRVCGDCH+AIKLIA IT REIILRDANRFHHFKDG CSC+DYW Sbjct: 680 EGMPIRVMKNLRVCGDCHSAIKLIAKITAREIILRDANRFHHFKDGFCSCRDYW 733 >ref|XP_004984577.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Setaria italica] Length = 706 Score = 110 bits (275), Expect = 7e-22 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EG+PIRVMKNLRVCGDCH+AIKLIA IT REIILRDANRFHHFKDG CSC+DYW Sbjct: 653 EGMPIRVMKNLRVCGDCHSAIKLIAKITSREIILRDANRFHHFKDGFCSCRDYW 706 >ref|NP_001173399.1| Os03g0317100 [Oryza sativa Japonica Group] gi|255674461|dbj|BAH92127.1| Os03g0317100 [Oryza sativa Japonica Group] Length = 706 Score = 110 bits (275), Expect = 7e-22 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EG+PIRVMKNLRVCGDCH+AIKLIA IT REIILRDANRFHHFKDG CSC+DYW Sbjct: 653 EGMPIRVMKNLRVCGDCHSAIKLIAKITSREIILRDANRFHHFKDGFCSCRDYW 706 >gb|ABF95626.1| pentatricopeptide, putative [Oryza sativa Japonica Group] gi|125586055|gb|EAZ26719.1| hypothetical protein OsJ_10627 [Oryza sativa Japonica Group] Length = 798 Score = 110 bits (275), Expect = 7e-22 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EG+PIRVMKNLRVCGDCH+AIKLIA IT REIILRDANRFHHFKDG CSC+DYW Sbjct: 653 EGMPIRVMKNLRVCGDCHSAIKLIAKITSREIILRDANRFHHFKDGFCSCRDYW 706 >gb|EAY89771.1| hypothetical protein OsI_11313 [Oryza sativa Indica Group] Length = 798 Score = 110 bits (274), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 EG+PIRVMKNLRVCGDCH+AIKLIA IT REI+LRDANRFHHFKDG CSC+DYW Sbjct: 653 EGMPIRVMKNLRVCGDCHSAIKLIAKITSREIVLRDANRFHHFKDGFCSCRDYW 706 >ref|XP_004157997.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Cucumis sativus] Length = 785 Score = 109 bits (272), Expect = 2e-21 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +2 Query: 5 GVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 G+PIRVMKNLRVCGDCH AIKLIA +TGREIILRDANRFHHFKDG CSC+DYW Sbjct: 733 GMPIRVMKNLRVCGDCHAAIKLIAKVTGREIILRDANRFHHFKDGSCSCRDYW 785 >ref|XP_004144359.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Cucumis sativus] Length = 785 Score = 109 bits (272), Expect = 2e-21 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +2 Query: 5 GVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 G+PIRVMKNLRVCGDCH AIKLIA +TGREIILRDANRFHHFKDG CSC+DYW Sbjct: 733 GMPIRVMKNLRVCGDCHAAIKLIAKVTGREIILRDANRFHHFKDGSCSCRDYW 785 >ref|XP_002319471.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222857847|gb|EEE95394.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 703 Score = 109 bits (272), Expect = 2e-21 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = +2 Query: 5 GVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 G PIRVMKNLRVCGDCH+AIKLIA +TGREIILRDANRFHHFKDGLCSC+D+W Sbjct: 651 GKPIRVMKNLRVCGDCHSAIKLIAQVTGREIILRDANRFHHFKDGLCSCRDFW 703 >gb|EMJ05367.1| hypothetical protein PRUPE_ppa017537mg [Prunus persica] Length = 631 Score = 108 bits (270), Expect = 3e-21 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = +2 Query: 2 EGVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 +G+PIRVMKNLR+CGDCH+AIKLI+ + GRE+ILRDANRFHHFKDGLCSC+DYW Sbjct: 578 QGMPIRVMKNLRICGDCHSAIKLISKVMGREVILRDANRFHHFKDGLCSCRDYW 631 >ref|XP_003558041.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Brachypodium distachyon] Length = 706 Score = 108 bits (270), Expect = 3e-21 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +2 Query: 5 GVPIRVMKNLRVCGDCHTAIKLIANITGREIILRDANRFHHFKDGLCSCKDYW 163 G+PIRVMKNLRVCGDCH+AIKLI IT REIILRDANRFHHFKDGLCSC+DYW Sbjct: 654 GMPIRVMKNLRVCGDCHSAIKLITKITSREIILRDANRFHHFKDGLCSCRDYW 706