BLASTX nr result
ID: Rehmannia23_contig00010003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00010003 (1897 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006484763.1| PREDICTED: LOW QUALITY PROTEIN: TATA-binding... 51 9e-08 gb|EPS60302.1| hypothetical protein M569_14502, partial [Genlise... 61 1e-06 gb|EPS60200.1| hypothetical protein M569_14604 [Genlisea aurea] 61 1e-06 ref|NP_001190085.1| TATA-binding protein-associated factor BTAF1... 47 2e-06 ref|XP_006650817.1| PREDICTED: nucleobase-ascorbate transporter ... 59 1e-05 >ref|XP_006484763.1| PREDICTED: LOW QUALITY PROTEIN: TATA-binding protein-associated factor BTAF1-like [Citrus sinensis] Length = 2078 Score = 50.8 bits (120), Expect(2) = 9e-08 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -2 Query: 1593 EYDIASDNFKNPKERLARQKQNLRRRFG 1510 EYDIA DN KNP+ERLARQKQNL+RR G Sbjct: 177 EYDIAIDNSKNPRERLARQKQNLKRRLG 204 Score = 34.3 bits (77), Expect(2) = 9e-08 Identities = 14/19 (73%), Positives = 19/19 (100%) Frame = -3 Query: 1649 SFDVNKLLDFGALVASGGR 1593 SFD+NK+L+FGAL+ASGG+ Sbjct: 121 SFDLNKVLEFGALLASGGQ 139 >gb|EPS60302.1| hypothetical protein M569_14502, partial [Genlisea aurea] Length = 150 Score = 61.2 bits (147), Expect = 1e-06 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 1897 PTALVPQMGGGNEEKAQVIQILQFVVWLNTLLQSW 1793 PTALVPQMGGGN EKAQVIQ L FV LNTLLQSW Sbjct: 21 PTALVPQMGGGNVEKAQVIQTLLFVAGLNTLLQSW 55 >gb|EPS60200.1| hypothetical protein M569_14604 [Genlisea aurea] Length = 268 Score = 61.2 bits (147), Expect = 1e-06 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 1897 PTALVPQMGGGNEEKAQVIQILQFVVWLNTLLQSW 1793 PTALVPQMGGGNEEKA+VIQ L FV LNTLLQ+W Sbjct: 58 PTALVPQMGGGNEEKAKVIQTLLFVAGLNTLLQTW 92 >ref|NP_001190085.1| TATA-binding protein-associated factor BTAF1 [Arabidopsis thaliana] gi|332645687|gb|AEE79208.1| protein root growth defective 3 [Arabidopsis thaliana] Length = 2129 Score = 47.4 bits (111), Expect(2) = 2e-06 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = -2 Query: 1593 EYDIASDNFKNPKERLARQKQNLRRRFG 1510 EYDI +DN KNP++R+ARQK+NLRRR G Sbjct: 172 EYDILNDNSKNPRDRVARQKKNLRRRLG 199 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 20/22 (90%) Frame = -3 Query: 1649 SFDVNKLLDFGALVASGGRNMI 1584 SF++NK+L+FGAL+ASGG+ I Sbjct: 122 SFEMNKVLEFGALLASGGQAFI 143 >ref|XP_006650817.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Oryza brachyantha] Length = 529 Score = 58.5 bits (140), Expect = 1e-05 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -1 Query: 1897 PTALVPQMGGGNEEKAQVIQILQFVVWLNTLLQSWM 1790 PTALVPQMGGGNEEKA+VIQ L FV +NTLLQS++ Sbjct: 55 PTALVPQMGGGNEEKARVIQTLLFVAGINTLLQSFL 90