BLASTX nr result
ID: Rehmannia23_contig00007911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00007911 (724 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF64710.1| putative transposase [Ipomoea tricolor] 51 3e-09 >dbj|BAF64710.1| putative transposase [Ipomoea tricolor] Length = 517 Score = 51.2 bits (121), Expect(3) = 3e-09 Identities = 27/80 (33%), Positives = 47/80 (58%) Frame = +3 Query: 3 KTHIEQYKKLFQEGRVYAIREFIVANFTDKYKTAAGKYKILFHGKTNVFEMFDKSFPKFM 182 K +E+Y + + G+VY+IR F+V + YKT+ KY + F+ KT V E+ D FP M Sbjct: 60 KEFVEKYSAMLKIGQVYSIRNFLVISNFYTYKTSPHKYMLKFYYKTVVRELKDIVFPSHM 119 Query: 183 YVLRNFREVARVENVDETML 242 + L+ ++ + +++E L Sbjct: 120 FRLQPLSQLKQKIDINEKEL 139 Score = 33.9 bits (76), Expect(3) = 3e-09 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +2 Query: 338 DIIGKVVSMQSAQSKEIGGRNIRFIDITLEDLE 436 D+IG VV + + Q K I G+ R ID LED E Sbjct: 141 DLIGMVVEINTPQDKVIAGKATRLIDFLLEDTE 173 Score = 22.3 bits (46), Expect(3) = 3e-09 Identities = 5/16 (31%), Positives = 13/16 (81%) Frame = +3 Query: 522 RLTCTLWEEYVDRILP 569 ++ CT+W+++V ++ P Sbjct: 176 QIKCTVWDDHVSKLEP 191