BLASTX nr result
ID: Rehmannia23_contig00007765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00007765 (631 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW22269.1| hypothetical protein PHAVU_005G140200g [Phaseolus... 102 9e-20 ref|XP_004505904.1| PREDICTED: 60S ribosomal protein L35-like [C... 102 9e-20 gb|ESW14693.1| hypothetical protein PHAVU_007G009400g [Phaseolus... 101 2e-19 gb|AFK40432.1| unknown [Lotus japonicus] 101 2e-19 emb|CBI33174.3| unnamed protein product [Vitis vinifera] 101 2e-19 ref|XP_002282289.1| PREDICTED: 60S ribosomal protein L35-like [V... 101 2e-19 ref|XP_006366921.1| PREDICTED: 60S ribosomal protein L35-like [S... 100 3e-19 ref|XP_004236769.1| PREDICTED: 60S ribosomal protein L35-like [S... 100 3e-19 ref|NP_001275032.1| uncharacterized protein LOC102577759 [Solanu... 100 3e-19 gb|AEC10955.1| ribosomal protein L35 [Camellia sinensis] 100 3e-19 ref|XP_002308483.1| 60S ribosomal protein L35 [Populus trichocar... 100 3e-19 ref|XP_006350745.1| PREDICTED: 60S ribosomal protein L35-like is... 100 5e-19 ref|XP_006350744.1| PREDICTED: 60S ribosomal protein L35-like is... 100 5e-19 ref|XP_006350743.1| PREDICTED: 60S ribosomal protein L35-like is... 100 5e-19 ref|NP_001234116.1| 60S ribosomal protein L35-like [Solanum lyco... 100 5e-19 ref|XP_006436132.1| hypothetical protein CICLE_v10033083mg [Citr... 100 6e-19 ref|XP_006424735.1| hypothetical protein CICLE_v10029592mg [Citr... 100 6e-19 gb|EOY34164.1| Ribosomal L29 family protein [Theobroma cacao] 100 6e-19 gb|EOY18384.1| Ribosomal L29 family protein [Theobroma cacao] 100 6e-19 ref|XP_004497317.1| PREDICTED: 60S ribosomal protein L35-like [C... 100 6e-19 >gb|ESW22269.1| hypothetical protein PHAVU_005G140200g [Phaseolus vulgaris] Length = 123 Score = 102 bits (254), Expect = 9e-20 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 92 >ref|XP_004505904.1| PREDICTED: 60S ribosomal protein L35-like [Cicer arietinum] Length = 123 Score = 102 bits (254), Expect = 9e-20 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 92 >gb|ESW14693.1| hypothetical protein PHAVU_007G009400g [Phaseolus vulgaris] Length = 123 Score = 101 bits (251), Expect = 2e-19 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQKSALR+AYKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKSALRDAYKNKKYLPLDLRPKKTRAIR 92 >gb|AFK40432.1| unknown [Lotus japonicus] Length = 123 Score = 101 bits (251), Expect = 2e-19 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK+ALREAYKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKYLPLDLRPKKTRAIR 92 >emb|CBI33174.3| unnamed protein product [Vitis vinifera] Length = 174 Score = 101 bits (251), Expect = 2e-19 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK+ALREAYKNKKYLPLDLRPKKTRAIR Sbjct: 91 APNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKYLPLDLRPKKTRAIR 143 >ref|XP_002282289.1| PREDICTED: 60S ribosomal protein L35-like [Vitis vinifera] Length = 123 Score = 101 bits (251), Expect = 2e-19 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK+ALREAYKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKYLPLDLRPKKTRAIR 92 >ref|XP_006366921.1| PREDICTED: 60S ribosomal protein L35-like [Solanum tuberosum] Length = 123 Score = 100 bits (250), Expect = 3e-19 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLS+AQVLTVISQ+QKSALREAYKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSVAQVLTVISQRQKSALREAYKNKKYLPLDLRPKKTRAIR 92 >ref|XP_004236769.1| PREDICTED: 60S ribosomal protein L35-like [Solanum lycopersicum] Length = 123 Score = 100 bits (250), Expect = 3e-19 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQKSALRE YKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKSALREVYKNKKYLPLDLRPKKTRAIR 92 >ref|NP_001275032.1| uncharacterized protein LOC102577759 [Solanum tuberosum] gi|78191412|gb|ABB29927.1| unknown [Solanum tuberosum] Length = 122 Score = 100 bits (250), Expect = 3e-19 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQKSALRE YKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKSALREVYKNKKYLPLDLRPKKTRAIR 92 >gb|AEC10955.1| ribosomal protein L35 [Camellia sinensis] Length = 123 Score = 100 bits (250), Expect = 3e-19 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQKS LREAYKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKSVLREAYKNKKYLPLDLRPKKTRAIR 92 >ref|XP_002308483.1| 60S ribosomal protein L35 [Populus trichocarpa] gi|118484398|gb|ABK94076.1| unknown [Populus trichocarpa] gi|222854459|gb|EEE92006.1| 60S ribosomal protein L35 [Populus trichocarpa] Length = 123 Score = 100 bits (250), Expect = 3e-19 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKK+LPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKFLPLDLRPKKTRAIR 92 >ref|XP_006350745.1| PREDICTED: 60S ribosomal protein L35-like isoform X3 [Solanum tuberosum] Length = 123 Score = 100 bits (248), Expect = 5e-19 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK ALREAYKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKLALREAYKNKKYLPLDLRPKKTRAIR 92 >ref|XP_006350744.1| PREDICTED: 60S ribosomal protein L35-like isoform X2 [Solanum tuberosum] Length = 128 Score = 100 bits (248), Expect = 5e-19 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK ALREAYKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKLALREAYKNKKYLPLDLRPKKTRAIR 92 >ref|XP_006350743.1| PREDICTED: 60S ribosomal protein L35-like isoform X1 [Solanum tuberosum] Length = 129 Score = 100 bits (248), Expect = 5e-19 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK ALREAYKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKLALREAYKNKKYLPLDLRPKKTRAIR 92 >ref|NP_001234116.1| 60S ribosomal protein L35-like [Solanum lycopersicum] gi|62751093|dbj|BAD95794.1| similar to 60S ribosomal protein L35 [Solanum lycopersicum] Length = 123 Score = 100 bits (248), Expect = 5e-19 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK ALREAYKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKLALREAYKNKKYLPLDLRPKKTRAIR 92 >ref|XP_006436132.1| hypothetical protein CICLE_v10033083mg [Citrus clementina] gi|568865289|ref|XP_006486009.1| PREDICTED: 60S ribosomal protein L35-like [Citrus sinensis] gi|557538328|gb|ESR49372.1| hypothetical protein CICLE_v10033083mg [Citrus clementina] Length = 123 Score = 99.8 bits (247), Expect = 6e-19 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK+ALREAYKNKK+LPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKFLPLDLRPKKTRAIR 92 >ref|XP_006424735.1| hypothetical protein CICLE_v10029592mg [Citrus clementina] gi|568870084|ref|XP_006488242.1| PREDICTED: 60S ribosomal protein L35-like [Citrus sinensis] gi|557526669|gb|ESR37975.1| hypothetical protein CICLE_v10029592mg [Citrus clementina] Length = 123 Score = 99.8 bits (247), Expect = 6e-19 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK+ALREAYKNKK+LPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKFLPLDLRPKKTRAIR 92 >gb|EOY34164.1| Ribosomal L29 family protein [Theobroma cacao] Length = 159 Score = 99.8 bits (247), Expect = 6e-19 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK+ALREAYKNKK+LPLDLRPKKTRAIR Sbjct: 76 APNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKFLPLDLRPKKTRAIR 128 >gb|EOY18384.1| Ribosomal L29 family protein [Theobroma cacao] Length = 123 Score = 99.8 bits (247), Expect = 6e-19 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK+ALREAYKNKK+LPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKFLPLDLRPKKTRAIR 92 >ref|XP_004497317.1| PREDICTED: 60S ribosomal protein L35-like [Cicer arietinum] Length = 123 Score = 99.8 bits (247), Expect = 6e-19 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +1 Query: 1 APNKLSKIKVVRLSIAQVLTVISQKQKSALREAYKNKKYLPLDLRPKKTRAIR 159 APNKLSKIKVVRLSIAQVLTVISQKQK+ALRE YKNKKYLPLDLRPKKTRAIR Sbjct: 40 APNKLSKIKVVRLSIAQVLTVISQKQKAALREVYKNKKYLPLDLRPKKTRAIR 92