BLASTX nr result
ID: Rehmannia23_contig00006921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00006921 (556 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABL63124.1| MYB transcription factor [Catharanthus roseus] 62 1e-07 >gb|ABL63124.1| MYB transcription factor [Catharanthus roseus] Length = 350 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 2/71 (2%) Frame = +2 Query: 44 NINGFSVMPFPMTVGPVLLSMQGGHPVETSAYAQID-RVNNSSAMLVHHVPVVPMYTSST 220 N+NG+++ PFP+ VGP+LL +Q +P+E A+ D ++ N ML+ VP +P+ SS+ Sbjct: 230 NMNGYTIAPFPLAVGPILLPVQVHNPMENKAFHWGDHQLQNGPGMLLRTVPFIPVANSSS 289 Query: 221 MF-DLNLNQQV 250 DLNLNQ+V Sbjct: 290 AIRDLNLNQRV 300