BLASTX nr result
ID: Rehmannia23_contig00006860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00006860 (324 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70603.1| hypothetical protein M569_04157, partial [Genlise... 83 3e-14 ref|XP_004513686.1| PREDICTED: zinc finger CCCH domain-containin... 75 9e-12 ref|XP_004308123.1| PREDICTED: zinc finger CCCH domain-containin... 75 1e-11 gb|EMJ19231.1| hypothetical protein PRUPE_ppa006002mg [Prunus pe... 75 1e-11 gb|EXC11889.1| Zinc finger CCCH domain-containing protein 48 [Mo... 74 3e-11 ref|XP_002510854.1| F-box and wd40 domain protein, putative [Ric... 74 3e-11 gb|EOY23072.1| Zinc finger WD40 repeat protein 1 isoform 1 [Theo... 73 3e-11 ref|XP_006490309.1| PREDICTED: zinc finger CCCH domain-containin... 73 5e-11 ref|XP_006421832.1| hypothetical protein CICLE_v10005002mg [Citr... 73 5e-11 ref|XP_002318843.1| hypothetical protein POPTR_0012s13800g [Popu... 73 5e-11 ref|XP_002321881.2| hypothetical protein POPTR_0015s13760g [Popu... 72 6e-11 ref|XP_004141129.1| PREDICTED: zinc finger CCCH domain-containin... 71 1e-10 ref|XP_003548225.1| PREDICTED: zinc finger CCCH domain-containin... 71 1e-10 gb|ESW24345.1| hypothetical protein PHAVU_004G122600g [Phaseolus... 70 2e-10 ref|XP_003534022.1| PREDICTED: zinc finger CCCH domain-containin... 70 3e-10 ref|XP_006353383.1| PREDICTED: zinc finger CCCH domain-containin... 69 5e-10 ref|XP_004234345.1| PREDICTED: zinc finger CCCH domain-containin... 69 5e-10 gb|ABR17549.1| unknown [Picea sitchensis] 69 7e-10 gb|EMJ19209.1| hypothetical protein PRUPE_ppa005802mg [Prunus pe... 69 9e-10 ref|XP_006857936.1| hypothetical protein AMTR_s00069p00156070 [A... 67 2e-09 >gb|EPS70603.1| hypothetical protein M569_04157, partial [Genlisea aurea] Length = 440 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = +2 Query: 173 GSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 GS+DHSIRVWSLETLQ +QTL GH DVVMS+LCWD FLLSASLDK K Sbjct: 286 GSMDHSIRVWSLETLQCVQTLSGHTDVVMSVLCWDQFLLSASLDKTVK 333 >ref|XP_004513686.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Cicer arietinum] Length = 437 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/53 (67%), Positives = 42/53 (79%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+D++IRVW+LETLQ IQTL GH VVMS+LCWD FLLS SLDK K Sbjct: 284 NRLYSGSMDNTIRVWNLETLQCIQTLTGHTSVVMSVLCWDQFLLSCSLDKTVK 336 >ref|XP_004308123.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Fragaria vesca subsp. vesca] Length = 439 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+DHSIRVWSLE LQ IQTL H VVMS+LCWD FLLS+SLDK K Sbjct: 288 NRLYSGSMDHSIRVWSLENLQCIQTLTEHTSVVMSVLCWDQFLLSSSLDKKLK 340 >gb|EMJ19231.1| hypothetical protein PRUPE_ppa006002mg [Prunus persica] Length = 433 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+DHSIRVWSLETLQ IQTL H VVMS+LCWD FLLS SLD+ K Sbjct: 282 NRLYSGSMDHSIRVWSLETLQCIQTLTEHTSVVMSVLCWDQFLLSCSLDQQLK 334 >gb|EXC11889.1| Zinc finger CCCH domain-containing protein 48 [Morus notabilis] Length = 456 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/53 (66%), Positives = 41/53 (77%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+DHSI+VWSLETLQ +QTL H VVMS+LCW+ FLLS SLDK K Sbjct: 281 NRLYSGSMDHSIKVWSLETLQCLQTLTDHSSVVMSLLCWNQFLLSCSLDKTIK 333 >ref|XP_002510854.1| F-box and wd40 domain protein, putative [Ricinus communis] gi|223549969|gb|EEF51456.1| F-box and wd40 domain protein, putative [Ricinus communis] Length = 445 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/53 (66%), Positives = 41/53 (77%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+DHSIRVW+LETLQ +QTL H VVMS+LCWD FLLS SLD+ K Sbjct: 294 NRLYSGSMDHSIRVWNLETLQCVQTLTDHTSVVMSVLCWDQFLLSCSLDQKIK 346 >gb|EOY23072.1| Zinc finger WD40 repeat protein 1 isoform 1 [Theobroma cacao] Length = 447 Score = 73.2 bits (178), Expect = 3e-11 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+DHSIRVWSLETLQ +QTL H +VVMS+LCW+ FLLS SLD+ K Sbjct: 280 NRLYSGSMDHSIRVWSLETLQCLQTLTEHHNVVMSLLCWEQFLLSCSLDQTIK 332 >ref|XP_006490309.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Citrus sinensis] Length = 434 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/53 (67%), Positives = 41/53 (77%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+D+SIRVW+LETLQ IQTL H VVMS+LCWD FLLS SLDK K Sbjct: 284 NKLYSGSMDNSIRVWNLETLQCIQTLTEHTSVVMSLLCWDQFLLSCSLDKTIK 336 >ref|XP_006421832.1| hypothetical protein CICLE_v10005002mg [Citrus clementina] gi|557523705|gb|ESR35072.1| hypothetical protein CICLE_v10005002mg [Citrus clementina] Length = 434 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/53 (67%), Positives = 41/53 (77%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+D+SIRVW+LETLQ IQTL H VVMS+LCWD FLLS SLDK K Sbjct: 284 NKLYSGSMDNSIRVWNLETLQCIQTLTEHTSVVMSLLCWDQFLLSCSLDKTIK 336 >ref|XP_002318843.1| hypothetical protein POPTR_0012s13800g [Populus trichocarpa] gi|222859516|gb|EEE97063.1| hypothetical protein POPTR_0012s13800g [Populus trichocarpa] Length = 452 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/53 (66%), Positives = 41/53 (77%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+DHSI+VWSLETLQ IQTL H VVMS+LCW+ FLLS SLD+ K Sbjct: 301 NRLYSGSMDHSIKVWSLETLQCIQTLTDHTSVVMSLLCWEQFLLSCSLDQTIK 353 >ref|XP_002321881.2| hypothetical protein POPTR_0015s13760g [Populus trichocarpa] gi|550322663|gb|EEF06008.2| hypothetical protein POPTR_0015s13760g [Populus trichocarpa] Length = 454 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+DHSI+VWSLETLQ +QTL H VVMS+LCW+ FLLS SLD+ K Sbjct: 303 NRLYSGSMDHSIKVWSLETLQCVQTLKDHTSVVMSLLCWEQFLLSCSLDQTIK 355 >ref|XP_004141129.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Cucumis sativus] gi|449521989|ref|XP_004168011.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Cucumis sativus] Length = 432 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+DH+I+VWSLE+LQ +QTL H VVMS+LCW+ FLLS SLDK K Sbjct: 279 NRLYSGSMDHTIKVWSLESLQCLQTLTDHTSVVMSVLCWEQFLLSCSLDKTIK 331 >ref|XP_003548225.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Glycine max] Length = 427 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+D++IRVW+LETLQ +QTL H VVMS+LCWD FLLS SLDK K Sbjct: 275 NRLYSGSMDNTIRVWNLETLQCLQTLTEHTSVVMSVLCWDQFLLSCSLDKTVK 327 >gb|ESW24345.1| hypothetical protein PHAVU_004G122600g [Phaseolus vulgaris] Length = 424 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +2 Query: 173 GSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 GS+D++I+VW+LETLQ IQTL H VVMS+LCWD FLLS SLDK K Sbjct: 277 GSMDNTIKVWNLETLQCIQTLTEHTSVVMSVLCWDQFLLSCSLDKTVK 324 >ref|XP_003534022.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Glycine max] Length = 426 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+D++I+VW+LETLQ +QTL H VVMS+LCWD FLLS SLDK K Sbjct: 274 NRLYSGSMDNTIKVWNLETLQCLQTLTEHTSVVMSVLCWDQFLLSCSLDKTVK 326 >ref|XP_006353383.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Solanum tuberosum] Length = 432 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+D+SIRVW+LETL+ +Q L H VVMS+LCWD FLLS SLDK K Sbjct: 281 NRLYSGSMDNSIRVWNLETLECLQILTDHTSVVMSVLCWDQFLLSCSLDKTIK 333 >ref|XP_004234345.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Solanum lycopersicum] Length = 431 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GS+D+SIRVW+LETL+ +Q L H VVMS+LCWD FLLS SLDK K Sbjct: 280 NRLYSGSMDNSIRVWNLETLECLQILTDHTSVVMSVLCWDQFLLSCSLDKTIK 332 >gb|ABR17549.1| unknown [Picea sitchensis] Length = 370 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/53 (64%), Positives = 37/53 (69%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 D L GS+DH+IRVW LET Q IQTL H VVMS+L WD FLLS SLD K Sbjct: 241 DRLYSGSMDHTIRVWDLETFQCIQTLRDHTSVVMSLLLWDQFLLSCSLDNTVK 293 >gb|EMJ19209.1| hypothetical protein PRUPE_ppa005802mg [Prunus persica] Length = 443 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/53 (62%), Positives = 38/53 (71%) Frame = +2 Query: 158 DNLNVGSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 + L GSVDH+I+VW L TLQ + TL GH VVMS+LCWD FLLS SLD K Sbjct: 289 NRLYSGSVDHTIKVWDLYTLQGVLTLNGHSGVVMSLLCWDQFLLSCSLDDTIK 341 >ref|XP_006857936.1| hypothetical protein AMTR_s00069p00156070 [Amborella trichopoda] gi|548862038|gb|ERN19403.1| hypothetical protein AMTR_s00069p00156070 [Amborella trichopoda] Length = 424 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +2 Query: 173 GSVDHSIRVWSLETLQYIQTL*GHKDVVMSILCWDHFLLSASLDKICK 316 GS+D++I+VW L+TLQ +QTL H VVMS+LCWD FLLS SLD+ K Sbjct: 283 GSMDNTIKVWDLDTLQCLQTLSEHSSVVMSLLCWDQFLLSCSLDRTIK 330