BLASTX nr result
ID: Rehmannia23_contig00006506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00006506 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] 76 5e-12 >emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] Length = 115 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/62 (58%), Positives = 44/62 (70%) Frame = +2 Query: 62 MGIEEVMKFVVEKLKEALLSLENLGGEALAWFDNVFPPETRGDKISHWIHVAVPYLIAAV 241 MG E VMKFVVEKLKE L+ LEN GG + D VF P++RG+K+ HWI V P+LI + Sbjct: 1 MGAESVMKFVVEKLKELLVLLENFGGYLVDEVDKVFAPDSRGEKLRHWIQVGAPFLILGL 60 Query: 242 VL 247 VL Sbjct: 61 VL 62