BLASTX nr result
ID: Rehmannia23_contig00005871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00005871 (494 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61380.1| hypothetical protein M569_13417 [Genlisea aurea] 69 8e-10 gb|EPS67410.1| hypothetical protein M569_07367, partial [Genlise... 61 1e-07 >gb|EPS61380.1| hypothetical protein M569_13417 [Genlisea aurea] Length = 246 Score = 68.6 bits (166), Expect = 8e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +3 Query: 24 FQPQGMSDTRALENGKYFYDVSTEKYSSNHPYESLRGVRP 143 FQPQGMSDTRA +NGKYFYDV+ E++SS+HPYE+L+ P Sbjct: 172 FQPQGMSDTRAFQNGKYFYDVNAERFSSSHPYETLKAADP 211 >gb|EPS67410.1| hypothetical protein M569_07367, partial [Genlisea aurea] Length = 64 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/35 (68%), Positives = 33/35 (94%) Frame = +3 Query: 27 QPQGMSDTRALENGKYFYDVSTEKYSSNHPYESLR 131 +PQGMSDTR+ +NGKYFYDV+ E++SS+HPYE+L+ Sbjct: 14 RPQGMSDTRSFDNGKYFYDVNEERFSSSHPYEALK 48