BLASTX nr result
ID: Rehmannia23_contig00005752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00005752 (408 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001059160.1| Os07g0208000 [Oryza sativa Japonica Group] g... 73 5e-11 ref|XP_006365436.1| PREDICTED: 40S ribosomal protein S15a-1 [Sol... 73 5e-11 gb|ESW29158.1| hypothetical protein PHAVU_002G048000g [Phaseolus... 73 5e-11 gb|ESW26159.1| hypothetical protein PHAVU_003G095800g [Phaseolus... 73 5e-11 gb|ESW19782.1| hypothetical protein PHAVU_006G155200g [Phaseolus... 73 5e-11 gb|ESW26592.1| hypothetical protein PHAVU_003G132300g [Phaseolus... 73 5e-11 ref|XP_006379579.1| hypothetical protein POPTR_0008s05190g [Popu... 73 5e-11 ref|XP_006826960.1| hypothetical protein AMTR_s00010p00192110 [A... 73 5e-11 ref|XP_004957741.1| PREDICTED: 40S ribosomal protein S15a-1-like... 73 5e-11 ref|XP_004957743.1| PREDICTED: 40S ribosomal protein S15a-1-like... 73 5e-11 ref|XP_004964986.1| PREDICTED: 40S ribosomal protein S15a-1-like... 73 5e-11 ref|XP_004513036.1| PREDICTED: 40S ribosomal protein S15a-1-like... 73 5e-11 ref|XP_004503959.1| PREDICTED: 40S ribosomal protein S15a-1-like... 73 5e-11 ref|XP_006295517.1| hypothetical protein CARUB_v10024621mg [Caps... 73 5e-11 ref|XP_004307554.1| PREDICTED: 40S ribosomal protein S15a-1-like... 73 5e-11 ref|NP_001275136.1| uncharacterized protein LOC102577793 [Solanu... 73 5e-11 ref|NP_001046846.1| Os02g0478600 [Oryza sativa Japonica Group] g... 73 5e-11 ref|NP_172256.1| 40S ribosomal protein S15a-1 [Arabidopsis thali... 73 5e-11 emb|CAA42600.1| r-protein BnS15a [Brassica napus] 73 5e-11 sp|Q00332.3|RS15A_BRANA RecName: Full=40S ribosomal protein S15a... 73 5e-11 >ref|NP_001059160.1| Os07g0208000 [Oryza sativa Japonica Group] gi|573950515|ref|XP_006657549.1| PREDICTED: 40S ribosomal protein S15a-1-like [Oryza brachyantha] gi|582044878|pdb|3J60|W Chain W, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome gi|28411802|dbj|BAC57277.1| ribosomal protein S15 [Oryza sativa Japonica Group] gi|113610696|dbj|BAF21074.1| Os07g0208000 [Oryza sativa Japonica Group] gi|125557646|gb|EAZ03182.1| hypothetical protein OsI_25335 [Oryza sativa Indica Group] gi|125599505|gb|EAZ39081.1| hypothetical protein OsJ_23513 [Oryza sativa Japonica Group] gi|215693112|dbj|BAG88494.1| unnamed protein product [Oryza sativa Japonica Group] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_006365436.1| PREDICTED: 40S ribosomal protein S15a-1 [Solanum tuberosum] Length = 118 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 85 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 118 >gb|ESW29158.1| hypothetical protein PHAVU_002G048000g [Phaseolus vulgaris] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|ESW26159.1| hypothetical protein PHAVU_003G095800g [Phaseolus vulgaris] Length = 174 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 141 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 174 >gb|ESW19782.1| hypothetical protein PHAVU_006G155200g [Phaseolus vulgaris] Length = 183 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 150 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 183 >gb|ESW26592.1| hypothetical protein PHAVU_003G132300g [Phaseolus vulgaris] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_006379579.1| hypothetical protein POPTR_0008s05190g [Populus trichocarpa] gi|550332461|gb|ERP57376.1| hypothetical protein POPTR_0008s05190g [Populus trichocarpa] Length = 105 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 72 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 105 >ref|XP_006826960.1| hypothetical protein AMTR_s00010p00192110 [Amborella trichopoda] gi|548831389|gb|ERM94197.1| hypothetical protein AMTR_s00010p00192110 [Amborella trichopoda] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004957741.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Setaria italica] Length = 162 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 129 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 162 >ref|XP_004957743.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X4 [Setaria italica] gi|514809577|ref|XP_004979610.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004964986.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X1 [Setaria italica] gi|514762255|ref|XP_004964987.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Setaria italica] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004513036.1| PREDICTED: 40S ribosomal protein S15a-1-like [Cicer arietinum] gi|514749501|ref|XP_004961874.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] gi|514784116|ref|XP_004970511.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004503959.1| PREDICTED: 40S ribosomal protein S15a-1-like [Cicer arietinum] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_006295517.1| hypothetical protein CARUB_v10024621mg [Capsella rubella] gi|482564225|gb|EOA28415.1| hypothetical protein CARUB_v10024621mg [Capsella rubella] Length = 137 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 104 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 137 >ref|XP_004307554.1| PREDICTED: 40S ribosomal protein S15a-1-like [Fragaria vesca subsp. vesca] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|NP_001275136.1| uncharacterized protein LOC102577793 [Solanum tuberosum] gi|357125783|ref|XP_003564569.1| PREDICTED: 40S ribosomal protein S15a-1-like [Brachypodium distachyon] gi|357133356|ref|XP_003568291.1| PREDICTED: 40S ribosomal protein S15a-1-like [Brachypodium distachyon] gi|470116878|ref|XP_004294600.1| PREDICTED: 40S ribosomal protein S15a-1-like [Fragaria vesca subsp. vesca] gi|502125485|ref|XP_004498944.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X1 [Cicer arietinum] gi|502125487|ref|XP_004498945.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Cicer arietinum] gi|565380677|ref|XP_006356722.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X1 [Solanum tuberosum] gi|565380679|ref|XP_006356723.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Solanum tuberosum] gi|565381980|ref|XP_006357333.1| PREDICTED: 40S ribosomal protein S15a-1-like [Solanum tuberosum] gi|565381982|ref|XP_006357334.1| PREDICTED: 40S ribosomal protein S15a-1-like [Solanum tuberosum] gi|76573307|gb|ABA46758.1| unknown [Solanum tuberosum] gi|77745497|gb|ABB02647.1| unknown [Solanum tuberosum] gi|301641374|gb|ADK87348.1| 40S ribosomal protein S15a [Triticum aestivum] gi|388511815|gb|AFK43969.1| unknown [Medicago truncatula] gi|474186081|gb|EMS57914.1| 40S ribosomal protein S15a-1 [Triticum urartu] gi|475534291|gb|EMT08545.1| 40S ribosomal protein S15a-1 [Aegilops tauschii] gi|475603932|gb|EMT25572.1| 40S ribosomal protein S15a-1 [Aegilops tauschii] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|NP_001046846.1| Os02g0478600 [Oryza sativa Japonica Group] gi|573919371|ref|XP_006647300.1| PREDICTED: 40S ribosomal protein S15a-1-like [Oryza brachyantha] gi|47848234|dbj|BAD22059.1| putative ribosomal protein S15 [Oryza sativa Japonica Group] gi|113536377|dbj|BAF08760.1| Os02g0478600 [Oryza sativa Japonica Group] gi|149391263|gb|ABR25649.1| 40S ribosomal protein S15a [Oryza sativa Indica Group] gi|215767569|dbj|BAG99797.1| unnamed protein product [Oryza sativa Japonica Group] gi|218190741|gb|EEC73168.1| hypothetical protein OsI_07208 [Oryza sativa Indica Group] gi|222622857|gb|EEE56989.1| hypothetical protein OsJ_06729 [Oryza sativa Japonica Group] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|NP_172256.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|15238544|ref|NP_200793.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|42571385|ref|NP_973783.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|297796939|ref|XP_002866354.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|297815756|ref|XP_002875761.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|297849076|ref|XP_002892419.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|565435509|ref|XP_006281312.1| hypothetical protein CARUB_v10027365mg [Capsella rubella] gi|565468332|ref|XP_006292046.1| hypothetical protein CARUB_v10018235mg [Capsella rubella] gi|565491560|ref|XP_006303419.1| hypothetical protein CARUB_v10010626mg [Capsella rubella] gi|567159290|ref|XP_006418972.1| hypothetical protein EUTSA_v10002722mg [Eutrema salsugineum] gi|567177037|ref|XP_006400903.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] gi|567177041|ref|XP_006400904.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] gi|567177044|ref|XP_006400905.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] gi|567177047|ref|XP_006400906.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] gi|1173218|sp|P42798.2|R15A1_ARATH RecName: Full=40S ribosomal protein S15a-1 gi|8439890|gb|AAF75076.1|AC007583_12 Strong similarity to 40S ribosomal protein S15A from Arabidopsis thaliana gb|L27461. EST gb|R30315 comes from this gene [Arabidopsis thaliana] gi|12083302|gb|AAG48810.1|AF332447_1 putative ribosomal protein S15 [Arabidopsis thaliana] gi|13430744|gb|AAK25994.1|AF360284_1 putative ribosomal protein S15 [Arabidopsis thaliana] gi|14423370|gb|AAK62367.1|AF386922_1 40S ribosomal protein S15A [Arabidopsis thaliana] gi|440824|gb|AAA61608.1| ribosomal protein S15 [Arabidopsis thaliana] gi|2150130|gb|AAB58750.1| cytoplasmic ribosomal protein S15a [Arabidopsis thaliana] gi|9757906|dbj|BAB08353.1| 40S ribosomal protein S15A [Arabidopsis thaliana] gi|14334968|gb|AAK59661.1| putative cytoplasmic ribosomal protein S15a [Arabidopsis thaliana] gi|14596085|gb|AAK68770.1| Putative 40S ribosomal protein S15A [Arabidopsis thaliana] gi|15293213|gb|AAK93717.1| putative ribosomal protein S15 [Arabidopsis thaliana] gi|17104627|gb|AAL34202.1| putative cytoplasmic ribosomal protein S15a [Arabidopsis thaliana] gi|20148287|gb|AAM10034.1| similar to 40S ribosomal protein S15A [Arabidopsis thaliana] gi|20148721|gb|AAM10251.1| similar to 40S ribosomal protein S15A [Arabidopsis thaliana] gi|21593169|gb|AAM65118.1| cytoplasmic ribosomal protein S15a-like [Arabidopsis thaliana] gi|21593909|gb|AAM65874.1| cytoplasmic ribosomal protein S15a-like [Arabidopsis thaliana] gi|23397065|gb|AAN31818.1| putative cytoplasmic ribosomal protein S15a [Arabidopsis thaliana] gi|222424838|dbj|BAH20371.1| AT1G07770 [Arabidopsis thaliana] gi|297312189|gb|EFH42613.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|297321599|gb|EFH52020.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|297338261|gb|EFH68678.1| RPS15A [Arabidopsis lyrata subsp. lyrata] gi|332009859|gb|AED97242.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|332190056|gb|AEE28177.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|332190057|gb|AEE28178.1| 40S ribosomal protein S15a-1 [Arabidopsis thaliana] gi|482550016|gb|EOA14210.1| hypothetical protein CARUB_v10027365mg [Capsella rubella] gi|482560753|gb|EOA24944.1| hypothetical protein CARUB_v10018235mg [Capsella rubella] gi|482572130|gb|EOA36317.1| hypothetical protein CARUB_v10010626mg [Capsella rubella] gi|557096900|gb|ESQ37408.1| hypothetical protein EUTSA_v10002722mg [Eutrema salsugineum] gi|557101993|gb|ESQ42356.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] gi|557101994|gb|ESQ42357.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] gi|557101995|gb|ESQ42358.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] gi|557101996|gb|ESQ42359.1| hypothetical protein EUTSA_v10015007mg [Eutrema salsugineum] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >emb|CAA42600.1| r-protein BnS15a [Brassica napus] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >sp|Q00332.3|RS15A_BRANA RecName: Full=40S ribosomal protein S15a; AltName: Full=PPCB8 gi|17863|emb|CAA42599.1| r-protein BnS15a [Brassica napus] gi|119720818|gb|ABL97979.1| 40S ribosomal protein S15a [Brassica rapa] Length = 130 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 408 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 307 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 97 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130