BLASTX nr result
ID: Rehmannia23_contig00005442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00005442 (423 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycin... 112 7e-23 gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indi... 110 3e-22 gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Gr... 109 3e-22 ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus... 108 6e-22 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 108 1e-21 ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [C... 107 1e-21 ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, part... 107 2e-21 gb|ACU14391.1| unknown [Glycine max] 106 3e-21 gb|AAV88601.1| low temperature and salt responsive protein [Cenc... 106 3e-21 ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like is... 105 6e-21 gb|EOY11776.1| Stress-induced hydrophobic peptide [Theobroma cacao] 105 6e-21 ref|XP_003536025.1| PREDICTED: hydrophobic protein LTI6A-like [G... 105 6e-21 gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus pe... 105 8e-21 gb|ACU14681.1| unknown [Glycine max] 105 8e-21 gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK257... 105 8e-21 ref|XP_006658870.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-20 ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like is... 104 1e-20 ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [G... 104 1e-20 ref|NP_001147403.1| hydrophobic protein LTI6A [Zea mays] gi|1956... 104 1e-20 ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like is... 104 1e-20 >ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycine max] Length = 104 Score = 112 bits (279), Expect = 7e-23 Identities = 53/75 (70%), Positives = 60/75 (80%) Frame = +2 Query: 5 NYFSPINSSWKYQIRKEKKMADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLF 184 NYF S + R+ K DG A C+DI+LAI+LPPLGVFLK+GCQVEFWICL+LTLF Sbjct: 30 NYFLRKKVSKLRKSRETKMAGDGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLF 89 Query: 185 GYIPGIIYAVYAITK 229 GYIPGIIYAVYAITK Sbjct: 90 GYIPGIIYAVYAITK 104 >gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indica Group] gi|222618224|gb|EEE54356.1| hypothetical protein OsJ_01354 [Oryza sativa Japonica Group] Length = 56 Score = 110 bits (274), Expect = 3e-22 Identities = 47/56 (83%), Positives = 55/56 (98%) Frame = +2 Query: 62 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 M+DGTANC+DI++AI+LPPLGVFLKFGC+VEFW+CLLLT FGY+PGIIYAVYAITK Sbjct: 1 MSDGTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLTFFGYLPGIIYAVYAITK 56 >gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group] Length = 57 Score = 109 bits (273), Expect = 3e-22 Identities = 51/57 (89%), Positives = 56/57 (98%), Gaps = 1/57 (1%) Frame = +2 Query: 62 MAD-GTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 MAD GTANC+DI+LAI+LPPLGVFLKFGC++EFWICLLLTLFGYIPGIIYAVYAITK Sbjct: 1 MADKGTANCIDILLAIILPPLGVFLKFGCEMEFWICLLLTLFGYIPGIIYAVYAITK 57 >ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus communis] gi|223548547|gb|EEF50038.1| Hydrophobic protein LTI6A, putative [Ricinus communis] Length = 56 Score = 108 bits (271), Expect = 6e-22 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = +2 Query: 62 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 MADG A C+DI+LAI+LPPLGVFLK+GC+VEFWICL+LTLFGYIPGIIYAVYAITK Sbjct: 1 MADGAATCIDILLAIILPPLGVFLKYGCKVEFWICLILTLFGYIPGIIYAVYAITK 56 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] Length = 58 Score = 108 bits (269), Expect = 1e-21 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 1/57 (1%) Frame = +2 Query: 62 MAD-GTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 MAD GTA C+DIILAI+LPPLGVFLKFGC+VEFWICLLLT+FGYIPGIIYAVYAITK Sbjct: 1 MADEGTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 57 >ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 107 bits (268), Expect = 1e-21 Identities = 50/57 (87%), Positives = 54/57 (94%), Gaps = 1/57 (1%) Frame = +2 Query: 62 MAD-GTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 MAD GTANC+DI+LAILLPPLGVFLKFGC VEFWICL+LT FGYIPGIIYA+YAITK Sbjct: 1 MADEGTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLTFFGYIPGIIYAIYAITK 57 >ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] gi|557530402|gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] Length = 104 Score = 107 bits (266), Expect = 2e-21 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 1/62 (1%) Frame = +2 Query: 47 RKEKKMADG-TANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAI 223 + + KMADG TA CVDI+LA++LPPLGVFLKFGC+ EFWICLLLT+ GYIPGIIYAVYAI Sbjct: 42 KNQSKMADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 101 Query: 224 TK 229 TK Sbjct: 102 TK 103 >gb|ACU14391.1| unknown [Glycine max] Length = 57 Score = 106 bits (265), Expect = 3e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +2 Query: 68 DGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 DG A C+DI+LAI+LPPLGVFLK+GCQVEFWICL+LTLFGYIPGIIYAVYAITK Sbjct: 4 DGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVYAITK 57 >gb|AAV88601.1| low temperature and salt responsive protein [Cenchrus americanus] Length = 56 Score = 106 bits (265), Expect = 3e-21 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = +2 Query: 62 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 M+DGTANC+DIILAI+LPPLGVF KFGC VEFWICL+LT FGY+PGIIYAV+AITK Sbjct: 1 MSDGTANCIDIILAIILPPLGVFFKFGCGVEFWICLVLTFFGYLPGIIYAVWAITK 56 >ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Setaria italica] Length = 57 Score = 105 bits (262), Expect = 6e-21 Identities = 45/56 (80%), Positives = 53/56 (94%) Frame = +2 Query: 62 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 M +GTANCVDI++AI+LPPLGVFLKFGC+VEFW+CLLLT GY+PGIIYA+YAITK Sbjct: 1 MKEGTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLTFLGYLPGIIYAIYAITK 56 >gb|EOY11776.1| Stress-induced hydrophobic peptide [Theobroma cacao] Length = 58 Score = 105 bits (262), Expect = 6e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +2 Query: 68 DGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 D TA CVDI+LAI+LPPLGVFLK+GC+VEFWICL+LTLFGYIPGIIYAVYAITK Sbjct: 4 DSTATCVDILLAIILPPLGVFLKYGCEVEFWICLVLTLFGYIPGIIYAVYAITK 57 >ref|XP_003536025.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max] Length = 57 Score = 105 bits (262), Expect = 6e-21 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = +2 Query: 68 DGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 DG A C+DI+LAI+LPPLGVFLK+GCQVEFWICL+LTLFGYIPGIIYAVY+ITK Sbjct: 4 DGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVYSITK 57 >gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica] Length = 57 Score = 105 bits (261), Expect = 8e-21 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = +2 Query: 65 ADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 ++GTAN +DI++AILLPPLGVFLKFGC VEFWICLLLT+FGYIPGIIYAVYAITK Sbjct: 3 SEGTANFIDILIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAVYAITK 57 >gb|ACU14681.1| unknown [Glycine max] Length = 57 Score = 105 bits (261), Expect = 8e-21 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +2 Query: 68 DGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 DG A C+DI+LAI+LPPLGVFLK+GCQVEFWICL+LTLFGYIPGIIYAVY ITK Sbjct: 4 DGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVYTITK 57 >gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK25743.1| unknown [Picea sitchensis] gi|306015593|gb|ADM76850.1| low temprature induced-like protein [Picea sitchensis] gi|306015595|gb|ADM76851.1| low temprature induced-like protein [Picea sitchensis] gi|306015597|gb|ADM76852.1| low temprature induced-like protein [Picea sitchensis] gi|306015599|gb|ADM76853.1| low temprature induced-like protein [Picea sitchensis] gi|306015601|gb|ADM76854.1| low temprature induced-like protein [Picea sitchensis] gi|306015603|gb|ADM76855.1| low temprature induced-like protein [Picea sitchensis] gi|306015605|gb|ADM76856.1| low temprature induced-like protein [Picea sitchensis] gi|306015607|gb|ADM76857.1| low temprature induced-like protein [Picea sitchensis] gi|306015609|gb|ADM76858.1| low temprature induced-like protein [Picea sitchensis] gi|306015611|gb|ADM76859.1| low temprature induced-like protein [Picea sitchensis] gi|306015613|gb|ADM76860.1| low temprature induced-like protein [Picea sitchensis] gi|306015615|gb|ADM76861.1| low temprature induced-like protein [Picea sitchensis] gi|306015617|gb|ADM76862.1| low temprature induced-like protein [Picea sitchensis] gi|306015619|gb|ADM76863.1| low temprature induced-like protein [Picea sitchensis] gi|306015621|gb|ADM76864.1| low temprature induced-like protein [Picea sitchensis] gi|306015623|gb|ADM76865.1| low temprature induced-like protein [Picea sitchensis] gi|306015625|gb|ADM76866.1| low temprature induced-like protein [Picea sitchensis] gi|306015627|gb|ADM76867.1| low temprature induced-like protein [Picea sitchensis] gi|306015629|gb|ADM76868.1| low temprature induced-like protein [Picea sitchensis] gi|306015631|gb|ADM76869.1| low temprature induced-like protein [Picea sitchensis] gi|306015633|gb|ADM76870.1| low temprature induced-like protein [Picea sitchensis] gi|306015635|gb|ADM76871.1| low temprature induced-like protein [Picea sitchensis] gi|306015637|gb|ADM76872.1| low temprature induced-like protein [Picea sitchensis] gi|306015639|gb|ADM76873.1| low temprature induced-like protein [Picea sitchensis] gi|306015641|gb|ADM76874.1| low temprature induced-like protein [Picea sitchensis] gi|306015643|gb|ADM76875.1| low temprature induced-like protein [Picea sitchensis] gi|306015645|gb|ADM76876.1| low temprature induced-like protein [Picea sitchensis] gi|306015647|gb|ADM76877.1| low temprature induced-like protein [Picea sitchensis] gi|306015649|gb|ADM76878.1| low temprature induced-like protein [Picea sitchensis] gi|306015651|gb|ADM76879.1| low temprature induced-like protein [Picea sitchensis] gi|306015653|gb|ADM76880.1| low temprature induced-like protein [Picea sitchensis] gi|306015655|gb|ADM76881.1| low temprature induced-like protein [Picea sitchensis] gi|306015657|gb|ADM76882.1| low temprature induced-like protein [Picea sitchensis] gi|306015659|gb|ADM76883.1| low temprature induced-like protein [Picea sitchensis] gi|306015661|gb|ADM76884.1| low temprature induced-like protein [Picea sitchensis] gi|306015663|gb|ADM76885.1| low temprature induced-like protein [Picea sitchensis] gi|306015665|gb|ADM76886.1| low temprature induced-like protein [Picea sitchensis] gi|306015667|gb|ADM76887.1| low temprature induced-like protein [Picea sitchensis] gi|306015669|gb|ADM76888.1| low temprature induced-like protein [Picea sitchensis] gi|306015671|gb|ADM76889.1| low temprature induced-like protein [Picea sitchensis] gi|306015673|gb|ADM76890.1| low temprature induced-like protein [Picea sitchensis] gi|306015675|gb|ADM76891.1| low temprature induced-like protein [Picea sitchensis] gi|306015677|gb|ADM76892.1| low temprature induced-like protein [Picea sitchensis] gi|306015679|gb|ADM76893.1| low temprature induced-like protein [Picea sitchensis] gi|306015681|gb|ADM76894.1| low temprature induced-like protein [Picea sitchensis] gi|306015683|gb|ADM76895.1| low temprature induced-like protein [Picea sitchensis] Length = 59 Score = 105 bits (261), Expect = 8e-21 Identities = 45/56 (80%), Positives = 52/56 (92%) Frame = +2 Query: 62 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 M +GTANCVDIILAI+LPP+GVFLKFGC EFWICLLLT+ GY+PGI+YA+YAITK Sbjct: 1 MREGTANCVDIILAIILPPVGVFLKFGCHAEFWICLLLTILGYLPGIVYAIYAITK 56 >ref|XP_006658870.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Oryza brachyantha] Length = 678 Score = 104 bits (260), Expect = 1e-20 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +2 Query: 56 KKMADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 +KMAD TA C+DIILAI+LPPLGVF KFGC +EFWICLLLT FGY+PGIIYAV+ ITK Sbjct: 621 EKMADSTATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 678 >ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Setaria italica] gi|514773012|ref|XP_004967636.1| PREDICTED: hydrophobic protein LTI6B-like isoform X3 [Setaria italica] Length = 56 Score = 104 bits (260), Expect = 1e-20 Identities = 44/56 (78%), Positives = 53/56 (94%) Frame = +2 Query: 62 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 M++GTANC+DI++AI+LPPLGVFLKFGC+ EFWICLLLT GY+PGIIYA+YAITK Sbjct: 1 MSEGTANCIDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPGIIYAIYAITK 56 >ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max] Length = 57 Score = 104 bits (260), Expect = 1e-20 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = +2 Query: 68 DGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 D TA C+DI+LAI+LPPLGVFLK+GC+VEFWICL+LTLFGYIPGIIYAVYAITK Sbjct: 4 DSTATCIDILLAIILPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAVYAITK 57 >ref|NP_001147403.1| hydrophobic protein LTI6A [Zea mays] gi|195611068|gb|ACG27364.1| hydrophobic protein LTI6A [Zea mays] gi|195655849|gb|ACG47392.1| hydrophobic protein LTI6A [Zea mays] Length = 56 Score = 104 bits (260), Expect = 1e-20 Identities = 46/56 (82%), Positives = 52/56 (92%) Frame = +2 Query: 62 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 M+DGTA C+DIILAI+LPPLGVF KFGC VEFWICL+LT FGY+PGIIYAV+AITK Sbjct: 1 MSDGTATCIDIILAIILPPLGVFFKFGCGVEFWICLILTFFGYLPGIIYAVWAITK 56 >ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like isoform X4 [Setaria italica] Length = 56 Score = 104 bits (259), Expect = 1e-20 Identities = 45/56 (80%), Positives = 52/56 (92%) Frame = +2 Query: 62 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLTLFGYIPGIIYAVYAITK 229 M +GTANCVDI++AI+LPPLGVFLKFGC+ EFWICLLLT GY+PGIIYA+YAITK Sbjct: 1 MKEGTANCVDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPGIIYAIYAITK 56