BLASTX nr result
ID: Rehmannia23_contig00005440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00005440 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ06135.1| hypothetical protein PRUPE_ppa001857mg [Prunus pe... 55 9e-06 >gb|EMJ06135.1| hypothetical protein PRUPE_ppa001857mg [Prunus persica] Length = 754 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/56 (46%), Positives = 40/56 (71%) Frame = +2 Query: 152 QTRINQISQQLTLGTLEVEDNEDVLSTSEFQYGRMSDHQLNKEETELLDLEKREII 319 QTR++QI+QQL G E E++ED+ S + + S HQ+++E+ E L+LEKRE+I Sbjct: 103 QTRVDQITQQLKSGMSEAENDEDLPSAPQDPHHNSSRHQIDREDVEQLELEKREVI 158