BLASTX nr result
ID: Rehmannia23_contig00005064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00005064 (418 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006344193.1| PREDICTED: pentatricopeptide repeat-containi... 175 6e-42 gb|EPS62023.1| hypothetical protein M569_12769, partial [Genlise... 170 2e-40 emb|CBI26947.3| unnamed protein product [Vitis vinifera] 167 2e-39 ref|XP_002280156.1| PREDICTED: pentatricopeptide repeat-containi... 167 2e-39 emb|CAN69810.1| hypothetical protein VITISV_043106 [Vitis vinifera] 167 2e-39 ref|XP_006468786.1| PREDICTED: pentatricopeptide repeat-containi... 161 1e-37 ref|XP_006448333.1| hypothetical protein CICLE_v10017504mg, part... 161 1e-37 gb|EXB65587.1| hypothetical protein L484_025853 [Morus notabilis] 159 5e-37 ref|XP_004239403.1| PREDICTED: pentatricopeptide repeat-containi... 145 7e-33 ref|XP_004498286.1| PREDICTED: pentatricopeptide repeat-containi... 130 1e-28 ref|XP_006416136.1| hypothetical protein EUTSA_v10006897mg [Eutr... 124 1e-26 ref|XP_002893253.1| hypothetical protein ARALYDRAFT_313173 [Arab... 123 3e-26 ref|XP_004159312.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 122 5e-26 ref|XP_004135384.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 122 5e-26 ref|XP_006596228.1| PREDICTED: pentatricopeptide repeat-containi... 117 1e-24 gb|AAB72163.1| hypothetical protein [Arabidopsis thaliana] 115 6e-24 ref|NP_173709.1| pentatricopeptide repeat-containing protein [Ar... 115 6e-24 ref|XP_006303768.1| hypothetical protein CARUB_v10011979mg [Caps... 114 1e-23 ref|XP_003543970.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 ref|XP_002526312.1| pentatricopeptide repeat-containing protein,... 114 1e-23 >ref|XP_006344193.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565354592|ref|XP_006344194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565354594|ref|XP_006344195.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 761 Score = 175 bits (443), Expect = 6e-42 Identities = 75/130 (57%), Positives = 110/130 (84%) Frame = +3 Query: 27 WVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFCSVLEVLVQ 206 WV PD F++L+ DSDL + ++ SIR RPR+ L++FRWAEGQKGFK+SEF FC++L++L+Q Sbjct: 100 WVVPDCFHSLIYDSDLLVKILSSIRCRPRVALRLFRWAEGQKGFKYSEFSFCTILDILIQ 159 Query: 207 NGFMRSAYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSDVERCLWVF 386 NG+++SAYWVVERVI+ NMH +V++L+DGYLN ++S ++L++ L +YTK ++VE CL VF Sbjct: 160 NGWVKSAYWVVERVISSNMHKVVDLLVDGYLNLKVSVEILNIFLRIYTKNANVELCLLVF 219 Query: 387 DRMVRNGFLP 416 ++M+RN LP Sbjct: 220 EKMLRNEMLP 229 >gb|EPS62023.1| hypothetical protein M569_12769, partial [Genlisea aurea] Length = 642 Score = 170 bits (430), Expect = 2e-40 Identities = 80/124 (64%), Positives = 101/124 (81%) Frame = +3 Query: 45 FNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFCSVLEVLVQNGFMRS 224 FNALV +SDLF+ V++S R RPRMVL + RWAE Q+G+K +EF+FC+VL +LVQN MRS Sbjct: 1 FNALVTNSDLFIGVMNSFRDRPRMVLYMLRWAEAQEGYKPTEFIFCTVLGILVQNDVMRS 60 Query: 225 AYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSDVERCLWVFDRMVRN 404 AYWV+ERV+ MHSI++VLIDGYL+ + S KVL+LLLWLYTK S+ +RC VFD MVR+ Sbjct: 61 AYWVMERVLAAKMHSILDVLIDGYLSSDTSCKVLNLLLWLYTKNSEFDRCFLVFDNMVRS 120 Query: 405 GFLP 416 G LP Sbjct: 121 GHLP 124 >emb|CBI26947.3| unnamed protein product [Vitis vinifera] Length = 1078 Score = 167 bits (422), Expect = 2e-39 Identities = 77/138 (55%), Positives = 103/138 (74%) Frame = +3 Query: 3 PGAFRNIHWVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFC 182 P F N +W+ F ++ D DLF+ V+ S R PRM L++FRWAE Q GF+ SEFVFC Sbjct: 61 PSNFSNYYWLSHQ-FGPVIVDPDLFVRVLSSFRTSPRMALRLFRWAESQPGFRRSEFVFC 119 Query: 183 SVLEVLVQNGFMRSAYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSD 362 ++LE+L QN MRSAYWV+ERVIN NMH IV+VLI G ++ E+S K+LDLL+W+Y+KKS Sbjct: 120 AILEILAQNNLMRSAYWVMERVINANMHRIVDVLIGGCVSSEVSVKILDLLIWVYSKKSM 179 Query: 363 VERCLWVFDRMVRNGFLP 416 VE+CL VFD+M+++ P Sbjct: 180 VEQCLSVFDKMIKSRLSP 197 >ref|XP_002280156.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Vitis vinifera] Length = 718 Score = 167 bits (422), Expect = 2e-39 Identities = 77/138 (55%), Positives = 103/138 (74%) Frame = +3 Query: 3 PGAFRNIHWVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFC 182 P F N +W+ F ++ D DLF+ V+ S R PRM L++FRWAE Q GF+ SEFVFC Sbjct: 61 PSNFSNYYWLSHQ-FGPVIVDPDLFVRVLSSFRTSPRMALRLFRWAESQPGFRRSEFVFC 119 Query: 183 SVLEVLVQNGFMRSAYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSD 362 ++LE+L QN MRSAYWV+ERVIN NMH IV+VLI G ++ E+S K+LDLL+W+Y+KKS Sbjct: 120 AILEILAQNNLMRSAYWVMERVINANMHRIVDVLIGGCVSSEVSVKILDLLIWVYSKKSM 179 Query: 363 VERCLWVFDRMVRNGFLP 416 VE+CL VFD+M+++ P Sbjct: 180 VEQCLSVFDKMIKSRLSP 197 >emb|CAN69810.1| hypothetical protein VITISV_043106 [Vitis vinifera] Length = 847 Score = 167 bits (422), Expect = 2e-39 Identities = 77/138 (55%), Positives = 103/138 (74%) Frame = +3 Query: 3 PGAFRNIHWVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFC 182 P F N +W+ F ++ D DLF+ V+ S R PRM L++FRWAE Q GF+ SEFVFC Sbjct: 367 PSNFSNYYWLSHQ-FGPVIVDPDLFVRVLSSFRTSPRMALRLFRWAESQPGFRRSEFVFC 425 Query: 183 SVLEVLVQNGFMRSAYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSD 362 ++LE+L QN MRSAYWV+ERVIN NMH IV+VLI G ++ E+S K+LDLL+W+Y+KKS Sbjct: 426 AILEILAQNNLMRSAYWVMERVINANMHRIVDVLIGGCVSSEVSVKILDLLIWVYSKKSM 485 Query: 363 VERCLWVFDRMVRNGFLP 416 VE+CL VFD+M+++ P Sbjct: 486 VEQCLSVFDKMIKSRLSP 503 >ref|XP_006468786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Citrus sinensis] Length = 729 Score = 161 bits (407), Expect = 1e-37 Identities = 77/138 (55%), Positives = 105/138 (76%) Frame = +3 Query: 3 PGAFRNIHWVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFC 182 P AF N WV D+F A+V+D +L + V++ IR +PR+ L+ FRW E Q G K EFVFC Sbjct: 70 PWAFCNNRWVS-DHFQAVVSDPELLVRVLNRIREKPRIALRFFRWVETQPGVKRDEFVFC 128 Query: 183 SVLEVLVQNGFMRSAYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSD 362 ++LE+L+++G +RSAYWVVE V+ VNMH I++VLI G L+ +S K+LDLLL +YTKKS Sbjct: 129 TILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKSM 188 Query: 363 VERCLWVFDRMVRNGFLP 416 VE+CL VF++M+RNG LP Sbjct: 189 VEQCLLVFNKMLRNGLLP 206 >ref|XP_006448333.1| hypothetical protein CICLE_v10017504mg, partial [Citrus clementina] gi|557550944|gb|ESR61573.1| hypothetical protein CICLE_v10017504mg, partial [Citrus clementina] Length = 692 Score = 161 bits (407), Expect = 1e-37 Identities = 77/138 (55%), Positives = 105/138 (76%) Frame = +3 Query: 3 PGAFRNIHWVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFC 182 P AF N WV D+F A+V+D +L + V++ IR +PR+ L+ FRW E Q G K EFVFC Sbjct: 70 PWAFCNNRWVS-DHFQAVVSDPELLVRVLNRIREKPRIALRFFRWVETQPGVKRDEFVFC 128 Query: 183 SVLEVLVQNGFMRSAYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSD 362 ++LE+L+++G +RSAYWVVE V+ VNMH I++VLI G L+ +S K+LDLLL +YTKKS Sbjct: 129 TILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKSM 188 Query: 363 VERCLWVFDRMVRNGFLP 416 VE+CL VF++M+RNG LP Sbjct: 189 VEQCLLVFNKMLRNGLLP 206 >gb|EXB65587.1| hypothetical protein L484_025853 [Morus notabilis] Length = 742 Score = 159 bits (401), Expect = 5e-37 Identities = 79/140 (56%), Positives = 102/140 (72%), Gaps = 2/140 (1%) Frame = +3 Query: 3 PGAFRNIHWVGPDY-FNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVF 179 P AF N +WV PD+ ++ D LF V+ SIR +PR+ L+ FRWAEGQ F+ SEF F Sbjct: 74 PWAFSNPNWVVPDHQLRPVILDPYLFARVLRSIREKPRIALRFFRWAEGQPEFRRSEFGF 133 Query: 180 CSVLEVLVQNGFMRSAYWVVERVINV-NMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKK 356 C++LE+LV N MRSA+WV ER I V NMH IV+VLI GY+ ++S K+LDL+LW YTK+ Sbjct: 134 CAILEILVVNNLMRSAFWVAERAIVVNNMHGIVDVLIGGYVCDKVSIKILDLVLWAYTKE 193 Query: 357 SDVERCLWVFDRMVRNGFLP 416 S +E+CL V D+MVRNG LP Sbjct: 194 SMIEQCLSVLDKMVRNGLLP 213 >ref|XP_004239403.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Solanum lycopersicum] Length = 717 Score = 145 bits (365), Expect = 7e-33 Identities = 66/130 (50%), Positives = 93/130 (71%) Frame = +3 Query: 27 WVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFCSVLEVLVQ 206 WV PD F++L+ DSDL + ++ SIR RPR+ L++FRWAEGQKGFK+SEF FC++L++L+Q Sbjct: 77 WVVPDCFHSLIYDSDLLVKILSSIRCRPRVALRLFRWAEGQKGFKYSEFTFCTILDILIQ 136 Query: 207 NGFMRSAYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSDVERCLWVF 386 NG+++SAYWVVERVI+ NMH +V++L+DGYLN +CL VF Sbjct: 137 NGWVKSAYWVVERVISSNMHKVVDLLVDGYLNL---------------------KCLLVF 175 Query: 387 DRMVRNGFLP 416 +M+RN +P Sbjct: 176 QKMLRNEMMP 185 >ref|XP_004498286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Cicer arietinum] Length = 696 Score = 130 bits (328), Expect = 1e-28 Identities = 63/131 (48%), Positives = 93/131 (70%), Gaps = 6/131 (4%) Frame = +3 Query: 42 YFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFCSVLEVLVQNGFMR 221 +F A V +L L V++S+++RP + L+ FRWAE Q GFK SE F ++LE+L +NGFMR Sbjct: 45 HFRAAVTQPELLLRVLNSVKHRPILALRFFRWAEKQSGFKRSESAFVAILEILARNGFMR 104 Query: 222 SAYWVVERVINVNMHSIV-NVLIDGY-----LNKEISSKVLDLLLWLYTKKSDVERCLWV 383 SAY V+E+VI+V + ++V +VL++ Y E+S K+LDLLLW+Y KKS +E CL + Sbjct: 105 SAYCVMEKVIDVKIDAVVLDVLVNNYNGGAGCGSEVSVKLLDLLLWIYAKKSALENCLLI 164 Query: 384 FDRMVRNGFLP 416 F +M+ +G LP Sbjct: 165 FYKMIHSGLLP 175 >ref|XP_006416136.1| hypothetical protein EUTSA_v10006897mg [Eutrema salsugineum] gi|557093907|gb|ESQ34489.1| hypothetical protein EUTSA_v10006897mg [Eutrema salsugineum] Length = 752 Score = 124 bits (312), Expect = 1e-26 Identities = 58/124 (46%), Positives = 83/124 (66%) Frame = +3 Query: 45 FNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFCSVLEVLVQNGFMRS 224 F L+ D DL + V++ IR +P + F+W + Q+ K S F +VLE+L +N M Sbjct: 78 FRLLLTDPDLLIRVLNMIREKPEIAYHFFKWLQHQRDVKQSLQAFAAVLEILAENDLMNK 137 Query: 225 AYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSDVERCLWVFDRMVRN 404 AYWV ER I++ MH I ++LI+G +K+I+ K+LDLLLW+YTKKS E+CL F +M+R Sbjct: 138 AYWVAERSIDLGMHGIDDLLIEGGFDKKIAFKLLDLLLWVYTKKSMAEQCLLSFGKMIRK 197 Query: 405 GFLP 416 GFLP Sbjct: 198 GFLP 201 >ref|XP_002893253.1| hypothetical protein ARALYDRAFT_313173 [Arabidopsis lyrata subsp. lyrata] gi|297339095|gb|EFH69512.1| hypothetical protein ARALYDRAFT_313173 [Arabidopsis lyrata subsp. lyrata] Length = 1147 Score = 123 bits (308), Expect = 3e-26 Identities = 57/124 (45%), Positives = 81/124 (65%) Frame = +3 Query: 45 FNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFCSVLEVLVQNGFMRS 224 F L+ D DL + V++ IR +P + + F W + Q K S F ++LE+L +N M Sbjct: 114 FRLLLTDPDLLIRVLNMIRVKPEIAFRFFNWIQRQSDVKQSRQAFAAMLEILAENDLMSE 173 Query: 225 AYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSDVERCLWVFDRMVRN 404 AY V ER IN+ MH I ++LIDG +K ++ K+LDLLLW+YTKKS E+CL F++M+R Sbjct: 174 AYLVAERSINLGMHEIDDLLIDGNFDKLVALKLLDLLLWVYTKKSMAEKCLLSFEKMIRK 233 Query: 405 GFLP 416 GFLP Sbjct: 234 GFLP 237 >ref|XP_004159312.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Cucumis sativus] Length = 772 Score = 122 bits (306), Expect = 5e-26 Identities = 61/138 (44%), Positives = 83/138 (60%) Frame = +3 Query: 3 PGAFRNIHWVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFC 182 P AF +WV D F A++ D LF+ V+HS+R RPR+ L+ FRW Q FK SEFVFC Sbjct: 65 PWAFCKNNWVS-DQFGAVITDPHLFIRVLHSMRIRPRVALRFFRWVMAQPDFKESEFVFC 123 Query: 183 SVLEVLVQNGFMRSAYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSD 362 ++L++LV N M +AYWV+ERV++ MH +V+VLI G++ Sbjct: 124 AILDILVGNDLMHAAYWVMERVVSFEMHGVVDVLIAGHV--------------------- 162 Query: 363 VERCLWVFDRMVRNGFLP 416 CL VFD+M+RNG LP Sbjct: 163 --XCLLVFDKMIRNGLLP 178 >ref|XP_004135384.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Cucumis sativus] Length = 717 Score = 122 bits (306), Expect = 5e-26 Identities = 61/138 (44%), Positives = 83/138 (60%) Frame = +3 Query: 3 PGAFRNIHWVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFC 182 P AF +WV D F A++ D LF+ V+HS+R RPR+ L+ FRW Q FK SEFVFC Sbjct: 65 PWAFCKNNWVS-DQFGAVITDPHLFIRVLHSMRIRPRVALRFFRWVMAQPDFKESEFVFC 123 Query: 183 SVLEVLVQNGFMRSAYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSD 362 ++L++LV N M +AYWV+ERV++ MH +V+VLI G++ Sbjct: 124 AILDILVGNDLMHAAYWVMERVVSFEMHGVVDVLIAGHV--------------------- 162 Query: 363 VERCLWVFDRMVRNGFLP 416 CL VFD+M+RNG LP Sbjct: 163 --XCLLVFDKMIRNGLLP 178 >ref|XP_006596228.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X1 [Glycine max] gi|571510173|ref|XP_006596229.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X2 [Glycine max] gi|571510176|ref|XP_006596230.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X3 [Glycine max] gi|571510179|ref|XP_006596231.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X4 [Glycine max] gi|571510182|ref|XP_006596232.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X5 [Glycine max] gi|571510184|ref|XP_006596233.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X6 [Glycine max] gi|571510188|ref|XP_006596234.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X7 [Glycine max] gi|571510192|ref|XP_006596235.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X8 [Glycine max] gi|571510196|ref|XP_006596236.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X9 [Glycine max] gi|571510199|ref|XP_006596237.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X10 [Glycine max] gi|571510203|ref|XP_006596238.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X11 [Glycine max] gi|571510205|ref|XP_006596239.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X12 [Glycine max] gi|571510209|ref|XP_006596240.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X13 [Glycine max] gi|571510212|ref|XP_006596241.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X14 [Glycine max] gi|571510216|ref|XP_006596242.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X15 [Glycine max] Length = 697 Score = 117 bits (294), Expect = 1e-24 Identities = 56/125 (44%), Positives = 85/125 (68%), Gaps = 1/125 (0%) Frame = +3 Query: 45 FNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFCSVLEVLVQNGFMRS 224 F+A V + L + V++++R+RP + L+ FRWAE Q GFK SE + +L++L +NG MRS Sbjct: 50 FHAAVAEPQLLVRVLNTVRHRPAVALRFFRWAERQTGFKRSELTYAVILDILARNGLMRS 109 Query: 225 AYWVVERVINVNM-HSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSDVERCLWVFDRMVR 401 AY V+E+V++V M + +V+V+ + +LDLLLW+Y KKS +E+CL VF +MV Sbjct: 110 AYCVMEKVVSVKMENGVVDVVSSSEASMSSVKLILDLLLWIYAKKSMLEKCLLVFYKMVS 169 Query: 402 NGFLP 416 G LP Sbjct: 170 KGMLP 174 >gb|AAB72163.1| hypothetical protein [Arabidopsis thaliana] Length = 1152 Score = 115 bits (288), Expect = 6e-24 Identities = 55/124 (44%), Positives = 80/124 (64%) Frame = +3 Query: 45 FNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFCSVLEVLVQNGFMRS 224 F L+ D +L + V++ IR +P + + F W + Q K S F ++LE+L +N M Sbjct: 115 FRLLLTDPNLLIRVLNMIRVKPEIAFRFFNWIQRQSDVKQSRQAFAAMLEILAENDLMSE 174 Query: 225 AYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSDVERCLWVFDRMVRN 404 AY V ER I++ MH I ++LIDG +K I+ K+LDLLLW+YTKKS E+ L F++M+R Sbjct: 175 AYLVAERSIDLGMHEIDDLLIDGSFDKLIALKLLDLLLWVYTKKSMAEKFLLSFEKMIRK 234 Query: 405 GFLP 416 GFLP Sbjct: 235 GFLP 238 >ref|NP_173709.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806406|sp|P0C7Q9.1|PPR56_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g22960, mitochondrial; Flags: Precursor gi|332192194|gb|AEE30315.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 718 Score = 115 bits (288), Expect = 6e-24 Identities = 55/124 (44%), Positives = 80/124 (64%) Frame = +3 Query: 45 FNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFCSVLEVLVQNGFMRS 224 F L+ D +L + V++ IR +P + + F W + Q K S F ++LE+L +N M Sbjct: 78 FRLLLTDPNLLIRVLNMIRVKPEIAFRFFNWIQRQSDVKQSRQAFAAMLEILAENDLMSE 137 Query: 225 AYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSDVERCLWVFDRMVRN 404 AY V ER I++ MH I ++LIDG +K I+ K+LDLLLW+YTKKS E+ L F++M+R Sbjct: 138 AYLVAERSIDLGMHEIDDLLIDGSFDKLIALKLLDLLLWVYTKKSMAEKFLLSFEKMIRK 197 Query: 405 GFLP 416 GFLP Sbjct: 198 GFLP 201 >ref|XP_006303768.1| hypothetical protein CARUB_v10011979mg [Capsella rubella] gi|482572479|gb|EOA36666.1| hypothetical protein CARUB_v10011979mg [Capsella rubella] Length = 720 Score = 114 bits (286), Expect = 1e-23 Identities = 57/134 (42%), Positives = 82/134 (61%) Frame = +3 Query: 15 RNIHWVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFCSVLE 194 RN W F L+ D DL + V++ IR +P + + F W + Q K S F ++LE Sbjct: 71 RNRKW-SSHQFRLLLTDPDLLVRVLNMIREKPGIAFRFFNWIQRQSDVKQSLQAFAAMLE 129 Query: 195 VLVQNGFMRSAYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSDVERC 374 +L +NG M AY V ER I++ MH + ++LIDG +K I K+LDLLLW+YT+K E+C Sbjct: 130 ILAENGLMGEAYSVAERSIDLGMHEMDDLLIDGSFDKLIVIKLLDLLLWVYTRKYMAEKC 189 Query: 375 LWVFDRMVRNGFLP 416 F++M+R GFLP Sbjct: 190 FLSFEKMIRKGFLP 203 >ref|XP_003543970.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X1 [Glycine max] gi|571497069|ref|XP_006593783.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X2 [Glycine max] gi|571497071|ref|XP_006593784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X3 [Glycine max] gi|571497073|ref|XP_006593785.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X4 [Glycine max] gi|571497075|ref|XP_006593786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X5 [Glycine max] gi|571497078|ref|XP_006593787.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X6 [Glycine max] gi|571497080|ref|XP_006593788.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X7 [Glycine max] gi|571497082|ref|XP_006593789.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X8 [Glycine max] gi|571497084|ref|XP_006593790.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X9 [Glycine max] gi|571497086|ref|XP_006593791.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X10 [Glycine max] gi|571497088|ref|XP_006593792.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X11 [Glycine max] gi|571497090|ref|XP_006593793.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X12 [Glycine max] gi|571497092|ref|XP_006593794.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X13 [Glycine max] gi|571497094|ref|XP_006593795.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X14 [Glycine max] gi|571497096|ref|XP_006593796.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X15 [Glycine max] gi|571497098|ref|XP_006593797.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X16 [Glycine max] gi|571497100|ref|XP_006593798.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X17 [Glycine max] gi|571497102|ref|XP_006593799.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X18 [Glycine max] gi|571497104|ref|XP_006593800.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X19 [Glycine max] Length = 687 Score = 114 bits (285), Expect = 1e-23 Identities = 56/137 (40%), Positives = 89/137 (64%), Gaps = 1/137 (0%) Frame = +3 Query: 9 AFRNIHWVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFCSV 188 +F + + F+A V + L + V++++R RP + L+ FRWAE Q GFK SE + + Sbjct: 28 SFSTLQYNNKFLFHAAVAEPKLLVRVLNTVRNRPVVALRFFRWAERQTGFKRSEISYSVI 87 Query: 189 LEVLVQNGFMRSAYWVVERVINVNM-HSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSDV 365 L++L +NG MRSAY V+E+V++V M + +++V+ ++ +LDLLLW+Y KKS + Sbjct: 88 LDILARNGLMRSAYCVMEKVVSVKMENGVIDVVSSSEVSMPSVKLILDLLLWIYVKKSLL 147 Query: 366 ERCLWVFDRMVRNGFLP 416 E+CL VF +MV G LP Sbjct: 148 EKCLLVFYKMVSKGLLP 164 >ref|XP_002526312.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534393|gb|EEF36101.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 729 Score = 114 bits (285), Expect = 1e-23 Identities = 59/138 (42%), Positives = 85/138 (61%) Frame = +3 Query: 3 PGAFRNIHWVGPDYFNALVNDSDLFLSVIHSIRYRPRMVLKIFRWAEGQKGFKHSEFVFC 182 P AF N +WV D FN+++ D L + V++SIR +P + L+ F+ Q GFK SE+ FC Sbjct: 85 PWAFCNQNWVS-DKFNSVITDPQLLIRVLYSIREKPTIALRFFKCVLTQPGFKTSEYAFC 143 Query: 183 SVLEVLVQNGFMRSAYWVVERVINVNMHSIVNVLIDGYLNKEISSKVLDLLLWLYTKKSD 362 ++L++LV N M+SAYWV+ER+I+ M+ IV+VLI GYLN + Sbjct: 144 AILQILVDNCLMKSAYWVMERIISFEMYGIVDVLIGGYLNYQ------------------ 185 Query: 363 VERCLWVFDRMVRNGFLP 416 CL VF++M+RN FLP Sbjct: 186 ---CLLVFEKMMRNRFLP 200