BLASTX nr result
ID: Rehmannia23_contig00004056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00004056 (736 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64483.1| hypothetical protein M569_10301, partial [Genlise... 72 2e-10 >gb|EPS64483.1| hypothetical protein M569_10301, partial [Genlisea aurea] Length = 96 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +3 Query: 270 DVLPVIIIPNAGRVVFMDAKKFMQLVEEKKKRVLAKKEAPL 392 D +PVIIIPNAGR V MDAKKF+QLVE+KKKR+LAKKEAPL Sbjct: 1 DAIPVIIIPNAGRFVSMDAKKFLQLVEDKKKRILAKKEAPL 41