BLASTX nr result
ID: Rehmannia23_contig00004004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00004004 (304 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60562.1| 14-3-3 h-1 protein [Genlisea aurea] 67 2e-09 gb|EPS73301.1| 14-3-3 h-1 protein [Genlisea aurea] 61 1e-07 emb|CBI19195.3| unnamed protein product [Vitis vinifera] 60 2e-07 sp|O65352.1|1433_HELAN RecName: Full=14-3-3-like protein gi|3153... 60 3e-07 gb|AGJ98234.1| PIB67 14-3-3 protein [Petunia x hybrida] 59 5e-07 gb|AAR98782.1| 14-3-3 protein isoform 20R [Solanum tuberosum] 59 5e-07 dbj|BAD10939.1| 14-3-3 protein [Nicotiana tabacum] gi|44917159|d... 59 5e-07 sp|Q43643.1|14332_SOLTU RecName: Full=14-3-3-like protein RA215 ... 59 5e-07 sp|P93210.1|14335_SOLLC RecName: Full=14-3-3 protein 5 gi|177117... 59 5e-07 emb|CBI33141.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002262802.1| PREDICTED: 14-3-3-like protein [Vitis vinife... 59 5e-07 gb|AAS78777.1| 14-3-3 protein [Solanum chacoense] 59 5e-07 emb|CAC84142.3| 14-3-3 protein [Nicotiana tabacum] 59 5e-07 ref|NP_001234107.1| 14-3-3 family protein [Solanum lycopersicum]... 59 5e-07 gb|EOX98736.1| General regulatory factor 2, OMEGA [Theobroma cacao] 59 7e-07 ref|XP_006423811.1| hypothetical protein CICLE_v10029087mg [Citr... 59 9e-07 gb|EOY15948.1| General regulatory factor 2, OMEGA [Theobroma cacao] 59 9e-07 ref|NP_001274876.1| 14-3-3-like protein RA215 [Solanum tuberosum... 58 1e-06 ref|NP_001267852.1| 14-3-3 protein [Vitis vinifera] gi|226295434... 58 1e-06 gb|ABY65001.1| 14-3-3b protein [Gossypium hirsutum] 58 1e-06 >gb|EPS60562.1| 14-3-3 h-1 protein [Genlisea aurea] Length = 255 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDDNSEEIKEAPK DNE Sbjct: 224 MQLLRDNLTLWTSDMQDDNSEEIKEAPKPDNE 255 >gb|EPS73301.1| 14-3-3 h-1 protein [Genlisea aurea] Length = 255 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDDNS+EIKEA K +NE Sbjct: 224 MQLLRDNLTLWTSDMQDDNSDEIKEASKPENE 255 >emb|CBI19195.3| unnamed protein product [Vitis vinifera] Length = 159 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKEAPK D+E Sbjct: 126 MQLLRDNLTLWTSDMQDDGADEIKEAPKRDDE 157 >sp|O65352.1|1433_HELAN RecName: Full=14-3-3-like protein gi|3153902|gb|AAC17447.1| 14-3-3-like protein [Helianthus annuus] Length = 259 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD +EE+KEAPK D++ Sbjct: 228 MQLLRDNLTLWTSDMQDDTAEEVKEAPKPDDQ 259 >gb|AGJ98234.1| PIB67 14-3-3 protein [Petunia x hybrida] Length = 256 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKEA K DNE Sbjct: 225 MQLLRDNLTLWTSDMQDDGTDEIKEAAKPDNE 256 >gb|AAR98782.1| 14-3-3 protein isoform 20R [Solanum tuberosum] Length = 255 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKE KADNE Sbjct: 224 MQLLRDNLTLWTSDMQDDGADEIKEPSKADNE 255 >dbj|BAD10939.1| 14-3-3 protein [Nicotiana tabacum] gi|44917159|dbj|BAD12180.1| 14-3-3 h-1 protein [Nicotiana tabacum] gi|44917161|dbj|BAD12181.1| 14-3-3 h-2 protein [Nicotiana tabacum] Length = 258 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKEA K DNE Sbjct: 225 MQLLRDNLTLWTSDMQDDGTDEIKEAAKPDNE 256 >sp|Q43643.1|14332_SOLTU RecName: Full=14-3-3-like protein RA215 gi|2916724|emb|CAA60800.1| 14-3-3 protein [Solanum tuberosum] Length = 254 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKE KADNE Sbjct: 223 MQLLRDNLTLWTSDMQDDGADEIKEPSKADNE 254 >sp|P93210.1|14335_SOLLC RecName: Full=14-3-3 protein 5 gi|1771172|emb|CAA65148.1| 14-3-3 protein [Solanum lycopersicum] Length = 255 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKE KADNE Sbjct: 224 MQLLRDNLTLWTSDMQDDGTDEIKEPSKADNE 255 >emb|CBI33141.3| unnamed protein product [Vitis vinifera] Length = 173 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD +EIKEAPK D E Sbjct: 142 MQLLRDNLTLWTSDMQDDGGDEIKEAPKHDEE 173 >ref|XP_002262802.1| PREDICTED: 14-3-3-like protein [Vitis vinifera] gi|147805242|emb|CAN64479.1| hypothetical protein VITISV_032972 [Vitis vinifera] Length = 255 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD +EIKEAPK D E Sbjct: 224 MQLLRDNLTLWTSDMQDDGGDEIKEAPKHDEE 255 >gb|AAS78777.1| 14-3-3 protein [Solanum chacoense] Length = 255 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKE KADNE Sbjct: 224 MQLLRDNLTLWTSDMQDDGTDEIKEPSKADNE 255 >emb|CAC84142.3| 14-3-3 protein [Nicotiana tabacum] Length = 258 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKEA K DNE Sbjct: 225 MQLLRDNLTLWTSDMQDDGTDEIKEAAKPDNE 256 >ref|NP_001234107.1| 14-3-3 family protein [Solanum lycopersicum] gi|15637116|gb|AAL04426.1| 14-3-3 family protein [Solanum lycopersicum] Length = 256 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKE KADNE Sbjct: 225 MQLLRDNLTLWTSDMQDDGTDEIKEPSKADNE 256 >gb|EOX98736.1| General regulatory factor 2, OMEGA [Theobroma cacao] Length = 261 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKEAPK ++E Sbjct: 227 MQLLRDNLTLWTSDMQDDGTDEIKEAPKREDE 258 >ref|XP_006423811.1| hypothetical protein CICLE_v10029087mg [Citrus clementina] gi|568879355|ref|XP_006492624.1| PREDICTED: 14-3-3 protein 6-like [Citrus sinensis] gi|557525745|gb|ESR37051.1| hypothetical protein CICLE_v10029087mg [Citrus clementina] Length = 261 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKEAPK + E Sbjct: 227 MQLLRDNLTLWTSDMQDDGTDEIKEAPKPEEE 258 >gb|EOY15948.1| General regulatory factor 2, OMEGA [Theobroma cacao] Length = 267 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD ++EIKEAPK + E Sbjct: 227 MQLLRDNLTLWTSDMQDDGADEIKEAPKREEE 258 >ref|NP_001274876.1| 14-3-3-like protein RA215 [Solanum tuberosum] gi|83284005|gb|ABC01910.1| 14-3-3 protein-like protein [Solanum tuberosum] Length = 255 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD +++IKE KADNE Sbjct: 224 MQLLRDNLTLWTSDMQDDGTDDIKEPSKADNE 255 >ref|NP_001267852.1| 14-3-3 protein [Vitis vinifera] gi|226295434|gb|ACO40495.1| 14-3-3 protein [Vitis vinifera] Length = 260 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDN TLWTSDMQDD ++EIKEAPK D+E Sbjct: 227 MQLLRDNHTLWTSDMQDDGADEIKEAPKRDDE 258 >gb|ABY65001.1| 14-3-3b protein [Gossypium hirsutum] Length = 268 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 2 MQLLRDNLTLWTSDMQDDNSEEIKEAPKADNE 97 MQLLRDNLTLWTSDMQDD +++IKEAPK D + Sbjct: 229 MQLLRDNLTLWTSDMQDDGADDIKEAPKRDEQ 260