BLASTX nr result
ID: Rehmannia23_contig00002320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00002320 (413 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADK35887.1| geranylgeranyl reductase [Sesamum indicum] 102 4e-20 ref|XP_002514749.1| geranylgeranyl hydrogenase, putative [Ricinu... 100 2e-19 gb|EXB44696.1| Geranylgeranyl diphosphate reductase [Morus notab... 100 3e-19 dbj|BAH10639.1| geranylgeranyl reductase [Hevea brasiliensis] 99 4e-19 ref|XP_006440606.1| hypothetical protein CICLE_v10020061mg [Citr... 99 6e-19 ref|XP_002317979.2| geranylgeranyl reductase family protein [Pop... 99 6e-19 gb|ABK95678.1| unknown [Populus trichocarpa] 99 6e-19 ref|XP_004138167.1| PREDICTED: geranylgeranyl diphosphate reduct... 99 8e-19 emb|CBI15217.3| unnamed protein product [Vitis vinifera] 99 8e-19 ref|XP_002284906.1| PREDICTED: geranylgeranyl diphosphate reduct... 99 8e-19 emb|CAN61003.1| hypothetical protein VITISV_009187 [Vitis vinifera] 99 8e-19 gb|AGN48012.1| geranylgeranyl hydrogenase [Cucumis melo] 98 1e-18 gb|EMJ10306.1| hypothetical protein PRUPE_ppa005324mg [Prunus pe... 98 1e-18 gb|AAP55675.1| geranylgeranyl reductase [Prunus persica] 98 1e-18 ref|XP_006477461.1| PREDICTED: geranylgeranyl diphosphate reduct... 98 1e-18 gb|EOY21872.1| Pyridine nucleotide-disulfide oxidoreductase fami... 98 1e-18 gb|EOY21871.1| Pyridine nucleotide-disulfide oxidoreductase fami... 98 1e-18 gb|EOY21870.1| Pyridine nucleotide-disulfide oxidoreductase fami... 98 1e-18 gb|ABD65460.1| geranylgeranyl dehydrogenase [Gossypium hirsutum] 98 1e-18 gb|ABD73016.1| geranylgeranyl reductase [Olea europaea] 98 1e-18 >gb|ADK35887.1| geranylgeranyl reductase [Sesamum indicum] Length = 465 Score = 102 bits (255), Expect = 4e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYKRVVPGNPL+DLKLAVNTIGSLVRANALRKEMEKLSV Sbjct: 414 ADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRKEMEKLSV 465 >ref|XP_002514749.1| geranylgeranyl hydrogenase, putative [Ricinus communis] gi|223546353|gb|EEF47855.1| geranylgeranyl hydrogenase, putative [Ricinus communis] Length = 465 Score = 100 bits (249), Expect = 2e-19 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLA NTIGSLVRANALRKEM KLSV Sbjct: 414 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAFNTIGSLVRANALRKEMNKLSV 465 >gb|EXB44696.1| Geranylgeranyl diphosphate reductase [Morus notabilis] Length = 467 Score = 99.8 bits (247), Expect = 3e-19 Identities = 48/52 (92%), Positives = 52/52 (100%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 A+EYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSL+RANALR+EM+KLSV Sbjct: 416 ANEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLIRANALRREMDKLSV 467 >dbj|BAH10639.1| geranylgeranyl reductase [Hevea brasiliensis] Length = 471 Score = 99.4 bits (246), Expect = 4e-19 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYK+VVPGNPLDDLKLA NTIGSLVRANALRKEM KLSV Sbjct: 420 ADEYVQKMTFDSYLYKKVVPGNPLDDLKLAFNTIGSLVRANALRKEMNKLSV 471 >ref|XP_006440606.1| hypothetical protein CICLE_v10020061mg [Citrus clementina] gi|557542868|gb|ESR53846.1| hypothetical protein CICLE_v10020061mg [Citrus clementina] Length = 462 Score = 99.0 bits (245), Expect = 6e-19 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYKRVVPGNPL+DLKLAVNTIGSLVRANALR+EM+KL++ Sbjct: 411 ADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLTI 462 >ref|XP_002317979.2| geranylgeranyl reductase family protein [Populus trichocarpa] gi|550326551|gb|EEE96199.2| geranylgeranyl reductase family protein [Populus trichocarpa] Length = 470 Score = 99.0 bits (245), Expect = 6e-19 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLS 153 ADEYVQKMTFDSYLYKRVVPGNPL+DLKLAVNTIGSLVRANALR+EM+KLS Sbjct: 419 ADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLS 469 >gb|ABK95678.1| unknown [Populus trichocarpa] Length = 470 Score = 99.0 bits (245), Expect = 6e-19 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLS 153 ADEYVQKMTFDSYLYKRVVPGNPL+DLKLAVNTIGSLVRANALR+EM+KLS Sbjct: 419 ADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLS 469 >ref|XP_004138167.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Cucumis sativus] gi|449477252|ref|XP_004154972.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Cucumis sativus] Length = 465 Score = 98.6 bits (244), Expect = 8e-19 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYK+VVPGNPLDDLKLAVNTIGSLVRANAL++EMEK+S+ Sbjct: 414 ADEYVQKMTFDSYLYKKVVPGNPLDDLKLAVNTIGSLVRANALKREMEKVSL 465 >emb|CBI15217.3| unnamed protein product [Vitis vinifera] Length = 351 Score = 98.6 bits (244), Expect = 8e-19 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYK+VVPGNPL+DLKLAVNTIGSLVRANALR+EM+K+SV Sbjct: 300 ADEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKMSV 351 >ref|XP_002284906.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Vitis vinifera] Length = 467 Score = 98.6 bits (244), Expect = 8e-19 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYK+VVPGNPL+DLKLAVNTIGSLVRANALR+EM+K+SV Sbjct: 416 ADEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKMSV 467 >emb|CAN61003.1| hypothetical protein VITISV_009187 [Vitis vinifera] Length = 447 Score = 98.6 bits (244), Expect = 8e-19 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYK+VVPGNPL+DLKLAVNTIGSLVRANALR+EM+K+SV Sbjct: 396 ADEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKMSV 447 >gb|AGN48012.1| geranylgeranyl hydrogenase [Cucumis melo] Length = 465 Score = 98.2 bits (243), Expect = 1e-18 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYKRVVPGNPL+DLKLAVNTIGSLVRANAL++EMEK+S+ Sbjct: 414 ADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALKREMEKVSL 465 >gb|EMJ10306.1| hypothetical protein PRUPE_ppa005324mg [Prunus persica] Length = 466 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYKRVVPGNP +DLKLAVNTIGSLVRANALR+EMEKL+V Sbjct: 415 ADEYVQKMTFDSYLYKRVVPGNPWEDLKLAVNTIGSLVRANALRREMEKLNV 466 >gb|AAP55675.1| geranylgeranyl reductase [Prunus persica] Length = 466 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYKRVVPGNP +DLKLAVNTIGSLVRANALR+EMEKL+V Sbjct: 415 ADEYVQKMTFDSYLYKRVVPGNPWEDLKLAVNTIGSLVRANALRREMEKLNV 466 >ref|XP_006477461.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Citrus sinensis] Length = 465 Score = 97.8 bits (242), Expect = 1e-18 Identities = 46/52 (88%), Positives = 52/52 (100%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYK+VVPGNPL+DLKLAVNTIGSLVRANALR+EM+KL++ Sbjct: 414 ADEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLTI 465 >gb|EOY21872.1| Pyridine nucleotide-disulfide oxidoreductase family protein isoform 3 [Theobroma cacao] Length = 365 Score = 97.8 bits (242), Expect = 1e-18 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYK V PGNPL+DLKLAVNTIGSLVRANALRKEMEKL+V Sbjct: 314 ADEYVQKMTFDSYLYKTVAPGNPLEDLKLAVNTIGSLVRANALRKEMEKLNV 365 >gb|EOY21871.1| Pyridine nucleotide-disulfide oxidoreductase family protein isoform 2 [Theobroma cacao] Length = 462 Score = 97.8 bits (242), Expect = 1e-18 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYK V PGNPL+DLKLAVNTIGSLVRANALRKEMEKL+V Sbjct: 411 ADEYVQKMTFDSYLYKTVAPGNPLEDLKLAVNTIGSLVRANALRKEMEKLNV 462 >gb|EOY21870.1| Pyridine nucleotide-disulfide oxidoreductase family protein isoform 1 [Theobroma cacao] Length = 463 Score = 97.8 bits (242), Expect = 1e-18 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYK V PGNPL+DLKLAVNTIGSLVRANALRKEMEKL+V Sbjct: 412 ADEYVQKMTFDSYLYKTVAPGNPLEDLKLAVNTIGSLVRANALRKEMEKLNV 463 >gb|ABD65460.1| geranylgeranyl dehydrogenase [Gossypium hirsutum] Length = 116 Score = 97.8 bits (242), Expect = 1e-18 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYK V PGNPL+DLKLAVNTIGSLVRANALRKEMEKL+V Sbjct: 65 ADEYVQKMTFDSYLYKTVAPGNPLEDLKLAVNTIGSLVRANALRKEMEKLNV 116 >gb|ABD73016.1| geranylgeranyl reductase [Olea europaea] Length = 462 Score = 97.8 bits (242), Expect = 1e-18 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 1 ADEYVQKMTFDSYLYKRVVPGNPLDDLKLAVNTIGSLVRANALRKEMEKLSV 156 ADEYVQKMTFDSYLYK+VVPGNPLDDLKLAVN IGSLVRAN LR+EMEKLSV Sbjct: 411 ADEYVQKMTFDSYLYKKVVPGNPLDDLKLAVNPIGSLVRANPLRREMEKLSV 462