BLASTX nr result
ID: Rehmannia23_contig00000263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00000263 (712 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265589.1| PREDICTED: uncharacterized protein LOC100262... 57 5e-06 ref|XP_006429726.1| hypothetical protein CICLE_v10013261mg [Citr... 57 6e-06 >ref|XP_002265589.1| PREDICTED: uncharacterized protein LOC100262493 [Vitis vinifera] gi|302142756|emb|CBI19959.3| unnamed protein product [Vitis vinifera] Length = 68 Score = 57.4 bits (137), Expect = 5e-06 Identities = 29/53 (54%), Positives = 30/53 (56%) Frame = +1 Query: 274 VDSVFAFVRXXXXXXXXXXXXXXXXXXXKDLTSRPEYNDILVKKPGGNDLWPY 432 V+SVF FVR KDLTSRPEYN ILVKKPGG D WPY Sbjct: 16 VNSVFTFVRYAEFEILFVLFFLIAFIIFKDLTSRPEYNQILVKKPGGPDWWPY 68 >ref|XP_006429726.1| hypothetical protein CICLE_v10013261mg [Citrus clementina] gi|568855455|ref|XP_006481320.1| PREDICTED: uncharacterized protein LOC102612073 [Citrus sinensis] gi|557531783|gb|ESR42966.1| hypothetical protein CICLE_v10013261mg [Citrus clementina] Length = 73 Score = 57.0 bits (136), Expect = 6e-06 Identities = 29/53 (54%), Positives = 30/53 (56%) Frame = +1 Query: 274 VDSVFAFVRXXXXXXXXXXXXXXXXXXXKDLTSRPEYNDILVKKPGGNDLWPY 432 V +VFAFVR KDL SRPEYN ILVKKPGG DLWPY Sbjct: 21 VSAVFAFVRLAEFEILFFLFLVITFIVFKDLISRPEYNQILVKKPGGIDLWPY 73