BLASTX nr result
ID: Rehmannia22_contig00040414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00040414 (384 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003606061.1| 50S ribosomal protein L2-B [Medicago truncat... 158 8e-37 ref|XP_003599582.1| 50S ribosomal protein L2 [Medicago truncatul... 158 8e-37 ref|XP_003605908.1| 50S ribosomal protein L2 [Medicago truncatul... 156 3e-36 gb|ACH47392.1| ribosomal protein L23 [Erodium chrysanthum] 144 1e-32 gb|AER12861.1| ribosomal protein L23 (chloroplast) [Oryza sativa... 118 4e-30 gb|AGP50796.1| ribosomal protein L23 (chloroplast) [Hordeum vulg... 116 1e-29 gb|AHH30481.1| ribosomal protein L23 (chloroplast) [Bartsia inae... 133 2e-29 ref|YP_008964909.1| ribosomal protein L23 (chloroplast) [Schwalb... 133 2e-29 ref|YP_008815980.1| ribosomal protein L23 (chloroplast) [Lindenb... 133 2e-29 ref|YP_007353957.1| ribosomal protein L23 (chloroplast) [Tectona... 133 2e-29 ref|YP_004940551.1| rpl23 gene product (chloroplast) [Boea hygro... 133 2e-29 gb|AGQ50374.1| ribosomal protein L23 (chloroplast) [Rumex acetos... 132 4e-29 ref|YP_008082775.1| ribosomal protein L23 [Prinsepia utilis] gi|... 132 4e-29 ref|YP_247642.1| ribosomal protein L23 [Cucumis sativus] gi|6816... 132 4e-29 ref|YP_005296142.1| rpl23 gene product (chloroplast) [Pentactina... 132 4e-29 gb|AEK71563.1| ribosomal protein L23 [Ruptiliocarpon caracolito] 132 4e-29 gb|AEK71504.1| ribosomal protein L23 [Leea guineensis] 132 4e-29 gb|AEK71491.1| ribosomal protein L23 [Juglans nigra] gi|34080724... 132 4e-29 gb|AEK71460.1| ribosomal protein L23 [Coriaria nepalensis] 132 4e-29 ref|YP_008081408.1| ribosomal protein L23 (chloroplast) [Tetrace... 132 4e-29 >ref|XP_003606061.1| 50S ribosomal protein L2-B [Medicago truncatula] gi|355507116|gb|AES88258.1| 50S ribosomal protein L2-B [Medicago truncatula] Length = 382 Score = 158 bits (399), Expect = 8e-37 Identities = 84/127 (66%), Positives = 86/127 (67%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLP KGRRM PIMGH HY+RMIIT Sbjct: 68 RTEIKHWVELFFGVKVIAMNSHRLPIKGRRMRPIMGHRPHYKRMIIT------------- 114 Query: 202 RT*IKILNSMAIHLYKTSTPSTRNGTVGSQVKSNPRNNLIYGQHHCGKGRNARGIITARH 23 MAIHLYKTS PSTR RN LIYGQHHCGKGRNARGIITA H Sbjct: 115 ---------MAIHLYKTSIPSTRT-----------RNRLIYGQHHCGKGRNARGIITAGH 154 Query: 22 RGGGHKR 2 RGGGHKR Sbjct: 155 RGGGHKR 161 >ref|XP_003599582.1| 50S ribosomal protein L2 [Medicago truncatula] gi|355488630|gb|AES69833.1| 50S ribosomal protein L2 [Medicago truncatula] Length = 236 Score = 158 bits (399), Expect = 8e-37 Identities = 84/127 (66%), Positives = 86/127 (67%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLP KGRRM PIMGH HY+RMIIT Sbjct: 68 RTEIKHWVELFFGVKVIAMNSHRLPIKGRRMRPIMGHRPHYKRMIIT------------- 114 Query: 202 RT*IKILNSMAIHLYKTSTPSTRNGTVGSQVKSNPRNNLIYGQHHCGKGRNARGIITARH 23 MAIHLYKTS PSTR RN LIYGQHHCGKGRNARGIITA H Sbjct: 115 ---------MAIHLYKTSIPSTRT-----------RNRLIYGQHHCGKGRNARGIITAGH 154 Query: 22 RGGGHKR 2 RGGGHKR Sbjct: 155 RGGGHKR 161 >ref|XP_003605908.1| 50S ribosomal protein L2 [Medicago truncatula] gi|355506963|gb|AES88105.1| 50S ribosomal protein L2 [Medicago truncatula] Length = 236 Score = 156 bits (394), Expect = 3e-36 Identities = 83/127 (65%), Positives = 85/127 (66%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLP GRRM PIMGH HY+RMIIT Sbjct: 68 RTEIKHWVELFFGVKVIAMNSHRLPINGRRMRPIMGHRPHYKRMIIT------------- 114 Query: 202 RT*IKILNSMAIHLYKTSTPSTRNGTVGSQVKSNPRNNLIYGQHHCGKGRNARGIITARH 23 MAIHLYKTS PSTR RN LIYGQHHCGKGRNARGIITA H Sbjct: 115 ---------MAIHLYKTSIPSTRT-----------RNRLIYGQHHCGKGRNARGIITAGH 154 Query: 22 RGGGHKR 2 RGGGHKR Sbjct: 155 RGGGHKR 161 >gb|ACH47392.1| ribosomal protein L23 [Erodium chrysanthum] Length = 250 Score = 144 bits (363), Expect = 1e-32 Identities = 79/137 (57%), Positives = 91/137 (66%), Gaps = 10/137 (7%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPL--- 212 + E+K+WVEL FGVKVIAMNSHRLPG R +G M Y+RMIIT++ G S+P L Sbjct: 42 KREIKYWVELLFGVKVIAMNSHRLPGTRRTP---LGRRMEYKRMIITVKQGDSLPYLIID 98 Query: 211 ------RKKRT*IKILNSMAIHLYKT-STPSTRNGTVGSQVKSNPRNNLIYGQHHCGKGR 53 KK I + K+ STP TR SQVKSNPRN+LIYG+HHCGKGR Sbjct: 99 DTENEMNKKELMASQRKDEGIEVNKSNSTPMTRTAVADSQVKSNPRNHLIYGRHHCGKGR 158 Query: 52 NARGIITARHRGGGHKR 2 NARGIITA HRGGGHKR Sbjct: 159 NARGIITAGHRGGGHKR 175 >gb|AER12861.1| ribosomal protein L23 (chloroplast) [Oryza sativa Indica Group] gi|353685119|gb|AER12884.1| ribosomal protein L23 (chloroplast) [Oryza sativa Indica Group] Length = 117 Score = 118 bits (295), Expect(2) = 4e-30 Identities = 52/62 (83%), Positives = 60/62 (96%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 +TE+KHWVELFFGVKV+A+NSHRLPGKGRRMGPI+GHTMHYRRMIITLQPGYSIP L ++ Sbjct: 32 KTEIKHWVELFFGVKVVAVNSHRLPGKGRRMGPILGHTMHYRRMIITLQPGYSIPLLDRE 91 Query: 202 RT 197 +T Sbjct: 92 KT 93 Score = 38.9 bits (89), Expect(2) = 4e-30 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -1 Query: 216 LLERKELKSKYLIAWRYIYTKLLPRAHAMEP 124 LL+R++ K +YLI R IYTK L RAHA EP Sbjct: 87 LLDREKTKGEYLIIRRNIYTKHLSRAHAREP 117 >gb|AGP50796.1| ribosomal protein L23 (chloroplast) [Hordeum vulgare subsp. vulgare] gi|521301070|gb|AGP50872.1| ribosomal protein L23 (chloroplast) [Hordeum vulgare subsp. spontaneum] gi|521301151|gb|AGP50952.1| ribosomal protein L23 (chloroplast) [Hordeum vulgare subsp. spontaneum] Length = 117 Score = 116 bits (291), Expect(2) = 1e-29 Identities = 51/62 (82%), Positives = 60/62 (96%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 +TE+KHWVELFFGVKV+A+NSHRLPGKGRR+GPI+GHTMHYRRMIITLQPGYSIP L ++ Sbjct: 32 KTEIKHWVELFFGVKVVAVNSHRLPGKGRRIGPILGHTMHYRRMIITLQPGYSIPLLDRE 91 Query: 202 RT 197 +T Sbjct: 92 KT 93 Score = 38.9 bits (89), Expect(2) = 1e-29 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -1 Query: 216 LLERKELKSKYLIAWRYIYTKLLPRAHAMEP 124 LL+R++ K +YLI R IYTK L RAHA EP Sbjct: 87 LLDREKTKGEYLIIRRNIYTKHLSRAHAREP 117 >gb|AHH30481.1| ribosomal protein L23 (chloroplast) [Bartsia inaequalis] gi|576598332|gb|AHH30494.1| ribosomal protein L23 (chloroplast) [Bartsia inaequalis] Length = 93 Score = 133 bits (335), Expect = 2e-29 Identities = 62/62 (100%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >ref|YP_008964909.1| ribosomal protein L23 (chloroplast) [Schwalbea americana] gi|575669270|ref|YP_008964926.1| ribosomal protein L23 (chloroplast) [Schwalbea americana] gi|560176743|emb|CDJ38674.1| ribosomal protein L23 (chloroplast) [Schwalbea americana] gi|560176760|emb|CDJ38701.1| ribosomal protein L23 (chloroplast) [Schwalbea americana] Length = 93 Score = 133 bits (335), Expect = 2e-29 Identities = 62/62 (100%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >ref|YP_008815980.1| ribosomal protein L23 (chloroplast) [Lindenbergia philippensis] gi|558603929|ref|YP_008815999.1| ribosomal protein L23 (chloroplast) [Lindenbergia philippensis] gi|557136907|emb|CDI43961.1| ribosomal protein L23 (chloroplast) [Lindenbergia philippensis] gi|557136926|emb|CDI43980.1| ribosomal protein L23 (chloroplast) [Lindenbergia philippensis] Length = 93 Score = 133 bits (335), Expect = 2e-29 Identities = 62/62 (100%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >ref|YP_007353957.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|442743026|ref|YP_007353978.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|568245174|ref|YP_008964119.1| ribosomal protein L23 (mitochondrion) [Ajuga reptans] gi|568247107|ref|YP_008964095.1| ribosomal protein L23 [Ajuga reptans] gi|568247133|ref|YP_008964077.1| ribosomal protein L23 [Ajuga reptans] gi|438687646|emb|CCP47173.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|438687667|emb|CCP47197.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|438688330|emb|CCP47262.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|438688351|emb|CCP47286.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|438688454|emb|CCP47351.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|438688475|emb|CCP47375.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|558697178|gb|AHA84933.1| ribosomal protein L23 [Ajuga reptans] gi|558697204|gb|AHA84959.1| ribosomal protein L23 [Ajuga reptans] gi|558697236|gb|AHA84990.1| ribosomal protein L23 (mitochondrion) [Ajuga reptans] Length = 93 Score = 133 bits (335), Expect = 2e-29 Identities = 62/62 (100%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >ref|YP_004940551.1| rpl23 gene product (chloroplast) [Boea hygrometrica] gi|364284048|ref|YP_004940573.1| rpl23 gene product (chloroplast) [Boea hygrometrica] gi|459014536|ref|YP_007507154.1| ribosomal protein L23 (chloroplast) [Salvia miltiorrhiza] gi|459014557|ref|YP_007507175.1| ribosomal protein L23 (chloroplast) [Salvia miltiorrhiza] gi|552541346|ref|YP_008592531.1| ribosomal protein L23 (chloroplast) [Andrographis paniculata] gi|552541367|ref|YP_008592552.1| ribosomal protein L23 (chloroplast) [Andrographis paniculata] gi|570699910|ref|YP_008992306.1| ribosomal protein L23 (mitochondrion) [Salvia miltiorrhiza] gi|290487722|gb|ADD30245.1| ribosomal protein L23 [Antirrhinum majus] gi|340549449|gb|AEK53271.1| ribosomal protein L23 (chloroplast) [Boea hygrometrica] gi|340549471|gb|AEK53293.1| ribosomal protein L23 (chloroplast) [Boea hygrometrica] gi|340807054|gb|AEK71662.1| ribosomal protein L23 [Antirrhinum majus] gi|401879784|gb|AFQ30971.1| ribosomal protein L23 (chloroplast) [Salvia miltiorrhiza] gi|401879807|gb|AFQ30994.1| ribosomal protein L23 (chloroplast) [Salvia miltiorrhiza] gi|410176196|gb|AFV61855.1| ribosomal protein L23 (chloroplast) [Origanum vulgare subsp. vulgare] gi|410176217|gb|AFV61876.1| ribosomal protein L23 (chloroplast) [Origanum vulgare subsp. vulgare] gi|532164879|gb|AGT79889.1| ribosomal protein L23 (chloroplast) [Andrographis paniculata] gi|532164900|gb|AGT79910.1| ribosomal protein L23 (chloroplast) [Andrographis paniculata] gi|534292280|gb|AGU16572.1| ribosomal protein L23 (mitochondrion) [Salvia miltiorrhiza] gi|573461994|emb|CCQ71663.1| ribosomal protein L23 (chloroplast) [Salvia miltiorrhiza] gi|573462017|emb|CCQ71686.1| ribosomal protein L23 (chloroplast) [Salvia miltiorrhiza] Length = 93 Score = 133 bits (335), Expect = 2e-29 Identities = 62/62 (100%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >gb|AGQ50374.1| ribosomal protein L23 (chloroplast) [Rumex acetosa] gi|523582330|gb|AGQ50383.1| ribosomal protein L23 (chloroplast) [Rumex acetosa] Length = 79 Score = 132 bits (333), Expect = 4e-29 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 18 RTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 77 Query: 202 RT 197 RT Sbjct: 78 RT 79 >ref|YP_008082775.1| ribosomal protein L23 [Prinsepia utilis] gi|511943735|ref|YP_008082794.1| ribosomal protein L23 [Prinsepia utilis] gi|501418864|gb|AGL94741.1| ribosomal protein L23 [Prinsepia utilis] gi|501418884|gb|AGL94761.1| ribosomal protein L23 [Prinsepia utilis] Length = 93 Score = 132 bits (333), Expect = 4e-29 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >ref|YP_247642.1| ribosomal protein L23 [Cucumis sativus] gi|68164866|ref|YP_247662.1| ribosomal protein L23 [Cucumis sativus] gi|91984034|ref|YP_567120.1| ribosomal protein L23 [Vitis vinifera] gi|91984057|ref|YP_567141.1| ribosomal protein L23 [Vitis vinifera] gi|283795009|ref|YP_003359400.1| ribosomal protein L23 (chloroplast) [Olea europaea] gi|283795031|ref|YP_003359422.1| ribosomal protein L23 (chloroplast) [Olea europaea] gi|330850784|ref|YP_004376462.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|330850806|ref|YP_004376484.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334700323|ref|YP_004563822.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334700345|ref|YP_004563844.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334701660|ref|YP_004564045.1| ribosomal protein L23 [Olea woodiana subsp. woodiana] gi|334701682|ref|YP_004564067.1| ribosomal protein L23 [Olea woodiana subsp. woodiana] gi|334701929|ref|YP_004564538.1| ribosomal protein L23 [Olea europaea subsp. maroccana] gi|334701951|ref|YP_004564560.1| ribosomal protein L23 [Olea europaea subsp. maroccana] gi|346578234|ref|YP_004841826.1| ribosomal protein L23 [Cucumis melo subsp. melo] gi|346578257|ref|YP_004841848.1| ribosomal protein L23 [Cucumis melo subsp. melo] gi|435856416|ref|YP_007317291.1| ribosomal protein L23 (chloroplast) [Camellia sinensis] gi|435856437|ref|YP_007317312.1| ribosomal protein L23 (chloroplast) [Camellia sinensis] gi|501770897|ref|YP_007889904.1| ribosomal protein L23 [Francoa sonchifolia] gi|501770914|ref|YP_007889920.1| ribosomal protein L23 [Francoa sonchifolia] gi|511348379|ref|YP_008081308.1| ribosomal protein L23 (chloroplast) [Catharanthus roseus] gi|511348400|ref|YP_008081329.1| ribosomal protein L23 (chloroplast) [Catharanthus roseus] gi|542688169|ref|YP_008520182.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|542688170|ref|YP_008520205.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|545719380|ref|YP_008578582.1| ribosomal protein L23 (chloroplast) [Asclepias nivea] gi|545719381|ref|YP_008578601.1| ribosomal protein L23 (chloroplast) [Asclepias nivea] gi|545907234|ref|YP_008578665.1| ribosomal protein L23 (chloroplast) [Asclepias syriaca] gi|545907252|ref|YP_008578684.1| ribosomal protein L23 (chloroplast) [Asclepias syriaca] gi|552539643|ref|YP_008592800.1| 50S ribosomal protein L23 (chloroplast) [Camellia cuspidata] gi|552539644|ref|YP_008592823.1| 50S ribosomal protein L23 (chloroplast) [Camellia cuspidata] gi|552540892|ref|YP_008592910.1| 50S ribosomal protein L23 (chloroplast) [Camellia danzaiensis] gi|552540917|ref|YP_008592886.1| 50S ribosomal protein L23 (chloroplast) [Camellia danzaiensis] gi|552540985|ref|YP_008592976.1| 50S ribosomal protein L23 (chloroplast) [Camellia impressinervis] gi|552540986|ref|YP_008592999.1| 50S ribosomal protein L23 (chloroplast) [Camellia impressinervis] gi|552541079|ref|YP_008593154.1| 50S ribosomal protein L23 (chloroplast) [Camellia yunnanensis] gi|552541080|ref|YP_008593177.1| 50S ribosomal protein L23 (chloroplast) [Camellia yunnanensis] gi|552546238|ref|YP_008593065.1| 50S ribosomal protein L23 (chloroplast) [Camellia pitardii] gi|552546239|ref|YP_008593088.1| 50S ribosomal protein L23 (chloroplast) [Camellia pitardii] gi|568244601|ref|YP_008963348.1| ribosomal protein L23 [Camellia oleifera] gi|568244624|ref|YP_008963371.1| ribosomal protein L23 [Camellia oleifera] gi|568244952|ref|YP_008963734.1| ribosomal protein L23 (chloroplast) [Liquidambar formosana] gi|568244973|ref|YP_008963755.1| ribosomal protein L23 (chloroplast) [Liquidambar formosana] gi|75317295|sp|Q4VZK6.1|RK23_CUCSA RecName: Full=50S ribosomal protein L23, chloroplastic gi|122246605|sp|Q0ZIV5.1|RK23_VITVI RecName: Full=50S ribosomal protein L23, chloroplastic gi|67511441|emb|CAJ00801.1| ribosomal protein L23 [Cucumis sativus] gi|67511461|emb|CAJ00821.1| ribosomal protein L23 [Cucumis sativus] gi|74027142|gb|AAZ94692.1| ribosomal protein L23 [Cucumis sativus] gi|74027159|gb|AAZ94709.1| ribosomal protein L23 [Cucumis sativus] gi|91701692|gb|ABE47576.1| ribosomal protein L23 [Vitis vinifera] gi|91701715|gb|ABE47599.1| ribosomal protein L23 [Vitis vinifera] gi|115432846|gb|ABI97459.1| ribosomal protein L23 [Cucumis sativus] gi|115432863|gb|ABI97476.1| ribosomal protein L23 [Cucumis sativus] gi|115498346|gb|ABI98788.1| ribosomal protein L23 [Cucumis sativus] gi|115498366|gb|ABI98808.1| ribosomal protein L23 [Cucumis sativus] gi|146261189|gb|ABQ14814.1| ribosomal protein L23 [Cercidiphyllum japonicum] gi|146261198|gb|ABQ14822.1| ribosomal protein L23 [Daphniphyllum sp. 205-82] gi|146261207|gb|ABQ14830.1| ribosomal protein L23 [Hamamelis japonica] gi|146261247|gb|ABQ14866.1| ribosomal protein L23 [Liquidambar styraciflua] gi|146261303|gb|ABQ14916.1| ribosomal protein L23 [Rhodoleia championii] gi|281428728|gb|ADA69967.1| ribosomal protein L23 (chloroplast) [Olea europaea] gi|281428750|gb|ADA69989.1| ribosomal protein L23 (chloroplast) [Olea europaea] gi|290487728|gb|ADD30248.1| ribosomal protein L23 [Ehretia acuminata] gi|290487730|gb|ADD30249.1| ribosomal protein L23 [Ilex cornuta] gi|290487738|gb|ADD30253.1| ribosomal protein L23 [Nerium oleander] gi|290487760|gb|ADD30264.1| ribosomal protein L23 [Liquidambar styraciflua] gi|291059295|gb|ADD72131.1| ribosomal protein L23 [Olea europaea] gi|291059318|gb|ADD72154.1| ribosomal protein L23 [Olea europaea] gi|325610348|gb|ADZ36323.1| ribosomal protein L23 [Camellia obtusifolia] gi|325610362|gb|ADZ36334.1| ribosomal protein L23 [Franklinia alatamaha] gi|325610370|gb|ADZ36341.1| ribosomal protein L23 [Gordonia lasianthus] gi|325610374|gb|ADZ36344.1| ribosomal protein L23 [Stewartia crassifolia] gi|325610378|gb|ADZ36347.1| ribosomal protein L23 [Stewartia rubiginosa] gi|325610391|gb|ADZ36358.1| ribosomal protein L23 [Symplocos paniculata] gi|325610399|gb|ADZ36365.1| ribosomal protein L23 [Ternstroemia gymnanthera] gi|326200322|gb|ADZ52361.1| ribosomal protein L23 [Asclepias syriaca] gi|326200341|gb|ADZ52380.1| ribosomal protein L23 [Asclepias syriaca] gi|328795474|emb|CBR30356.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|328795496|emb|CBR30378.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334084442|emb|CBR23872.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334084464|emb|CBR23894.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334084528|emb|CBR24665.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334084550|emb|CBR24688.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334084614|emb|CBR30449.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334084636|emb|CBR30472.1| ribosomal protein L23 [Olea europaea subsp. europaea] gi|334084700|emb|CBS29393.1| ribosomal protein L23 [Olea woodiana subsp. woodiana] gi|334084722|emb|CBS29416.1| ribosomal protein L23 [Olea woodiana subsp. woodiana] gi|334084905|emb|CBS29284.1| ribosomal protein L23 [Olea europaea subsp. maroccana] gi|334084927|emb|CBS29313.1| ribosomal protein L23 [Olea europaea subsp. maroccana] gi|334084991|emb|CBJ04339.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334085013|emb|CBJ04361.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334085077|emb|CBR23780.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|334085099|emb|CBR23802.1| ribosomal protein L23 [Olea europaea subsp. cuspidata] gi|340806977|gb|AEK71600.1| ribosomal protein L23 [Ehretia acuminata] gi|340806993|gb|AEK71614.1| ribosomal protein L23 [Ilex cornuta] gi|340807163|gb|AEK71757.1| ribosomal protein L23 [Liquidambar styraciflua] gi|340807171|gb|AEK71764.1| ribosomal protein L23 [Nerium oleander] gi|344030534|gb|AEM76935.1| ribosomal protein L23 [Cucumis melo subsp. melo] gi|344030557|gb|AEM76958.1| ribosomal protein L23 [Cucumis melo subsp. melo] gi|355331766|gb|AER52455.1| ribosomal protein L23 [Asclepias albicans] gi|355331784|gb|AER52473.1| ribosomal protein L23 [Asclepias albicans] gi|355331849|gb|AER52537.1| ribosomal protein L23 [Asclepias albicans] gi|355331867|gb|AER52555.1| ribosomal protein L23 [Asclepias albicans] gi|355331932|gb|AER52619.1| ribosomal protein L23 [Asclepias coulteri] gi|355331950|gb|AER52637.1| ribosomal protein L23 [Asclepias coulteri] gi|355332015|gb|AER52701.1| ribosomal protein L23 [Asclepias cutleri] gi|355332033|gb|AER52719.1| ribosomal protein L23 [Asclepias cutleri] gi|355332098|gb|AER52783.1| ribosomal protein L23 [Asclepias cutleri] gi|355332116|gb|AER52801.1| ribosomal protein L23 [Asclepias cutleri] gi|355332180|gb|AER52864.1| ribosomal protein L23 [Asclepias leptopus] gi|355332198|gb|AER52882.1| ribosomal protein L23 [Asclepias leptopus] gi|355332263|gb|AER52946.1| ribosomal protein L23 [Asclepias macrotis] gi|355332279|gb|AER52962.1| ribosomal protein L23 [Asclepias macrotis] gi|355332342|gb|AER53024.1| ribosomal protein L23 [Asclepias macrotis] gi|355332358|gb|AER53040.1| ribosomal protein L23 [Asclepias macrotis] gi|355332423|gb|AER53104.1| ribosomal protein L23 [Asclepias masonii] gi|355332441|gb|AER53122.1| ribosomal protein L23 [Asclepias masonii] gi|355332506|gb|AER53186.1| ribosomal protein L23 [Asclepias subaphylla] gi|355332524|gb|AER53204.1| ribosomal protein L23 [Asclepias subaphylla] gi|355332585|gb|AER53264.1| ribosomal protein L23 [Asclepias subaphylla] gi|355332603|gb|AER53282.1| ribosomal protein L23 [Asclepias subaphylla] gi|355332668|gb|AER53346.1| ribosomal protein L23 [Asclepias subulata] gi|355332686|gb|AER53364.1| ribosomal protein L23 [Asclepias subulata] gi|355332751|gb|AER53428.1| ribosomal protein L23 [Asclepias subulata] gi|355332769|gb|AER53446.1| ribosomal protein L23 [Asclepias subulata] gi|355332832|gb|AER53508.1| ribosomal protein L23 [Asclepias albicans x Asclepias subulata] gi|355332850|gb|AER53526.1| ribosomal protein L23 [Asclepias albicans x Asclepias subulata] gi|386268408|gb|AFJ00514.1| ribosomal protein L23 [Francoa sonchifolia] gi|386268425|gb|AFJ00531.1| ribosomal protein L23 [Francoa sonchifolia] gi|388893249|gb|AFK81341.1| ribosomal protein L23 [Camellia sinensis var. assamica] gi|388893272|gb|AFK81364.1| ribosomal protein L23 [Camellia sinensis var. assamica] gi|388893337|gb|AFK81428.1| ribosomal protein L23 [Camellia oleifera] gi|388893360|gb|AFK81451.1| ribosomal protein L23 [Camellia oleifera] gi|388893425|gb|AFK81515.1| ribosomal protein L23 [Camellia taliensis] gi|388893448|gb|AFK81538.1| ribosomal protein L23 [Camellia taliensis] gi|430728315|gb|AGA55639.1| ribosomal protein L23 (chloroplast) [Camellia sinensis] gi|430728336|gb|AGA55660.1| ribosomal protein L23 (chloroplast) [Camellia sinensis] gi|474452119|gb|AGI51187.1| ribosomal protein L23 (chloroplast) [Catharanthus roseus] gi|474452140|gb|AGI51208.1| ribosomal protein L23 (chloroplast) [Catharanthus roseus] gi|491650413|gb|AGL13473.1| ribosomal protein L23 (chloroplast) [Liquidambar formosana] gi|491650434|gb|AGL13494.1| ribosomal protein L23 (chloroplast) [Liquidambar formosana] gi|510934445|emb|CCQ09143.1| ribosomal protein L23 (chloroplast) [Olea europaea subsp. europaea] gi|510934467|emb|CCQ09165.1| ribosomal protein L23 (chloroplast) [Olea europaea subsp. europaea] gi|537362461|gb|AGU44269.1| 50S ribosomal protein L23 (chloroplast) [Camellia cuspidata] gi|537362462|gb|AGU44270.1| 50S ribosomal protein L23 (chloroplast) [Camellia cuspidata] gi|537362551|gb|AGU44358.1| 50S ribosomal protein L23 (chloroplast) [Camellia danzaiensis] gi|537362576|gb|AGU44383.1| 50S ribosomal protein L23 (chloroplast) [Camellia danzaiensis] gi|537362639|gb|AGU44445.1| 50S ribosomal protein L23 (chloroplast) [Camellia impressinervis] gi|537362640|gb|AGU44446.1| 50S ribosomal protein L23 (chloroplast) [Camellia impressinervis] gi|537362729|gb|AGU44534.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|537362730|gb|AGU44535.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|537362819|gb|AGU44623.1| 50S ribosomal protein L23 (chloroplast) [Camellia pitardii] gi|537362820|gb|AGU44624.1| 50S ribosomal protein L23 (chloroplast) [Camellia pitardii] gi|537362909|gb|AGU44712.1| 50S ribosomal protein L23 (chloroplast) [Camellia yunnanensis] gi|537362910|gb|AGU44713.1| 50S ribosomal protein L23 (chloroplast) [Camellia yunnanensis] gi|537362999|gb|AGU44801.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|537363000|gb|AGU44802.1| 50S ribosomal protein L23 (chloroplast) [Camellia taliensis] gi|544186380|gb|AGW04328.1| ribosomal protein L23 [Secamone afzelii] gi|544186458|gb|AGW04405.1| ribosomal protein L23 [Araujia sericifera] gi|544186536|gb|AGW04482.1| ribosomal protein L23 [Astephanus triflorus] gi|544186613|gb|AGW04558.1| ribosomal protein L23 [Eustegia minuta] gi|544186687|gb|AGW04631.1| ribosomal protein L23 [Marsdenia astephanoides] gi|544186765|gb|AGW04708.1| ribosomal protein L23 [Matelea biflora] gi|544186843|gb|AGW04785.1| ribosomal protein L23 [Orthosia scoparia] gi|544186921|gb|AGW04862.1| ribosomal protein L23 [Sisyranthus trichostomus] gi|544186999|gb|AGW04939.1| ribosomal protein L23 [Telosma cordata] gi|544187077|gb|AGW05016.1| ribosomal protein L23 [Vincetoxicum rossicum] gi|544187153|gb|AGW05091.1| ribosomal protein L23 (chloroplast) [Asclepias nivea] gi|544187154|gb|AGW05092.1| ribosomal protein L23 (chloroplast) [Asclepias nivea] gi|544187251|gb|AGW05179.1| ribosomal protein L23 (chloroplast) [Asclepias syriaca] gi|544187269|gb|AGW05197.1| ribosomal protein L23 (chloroplast) [Asclepias syriaca] gi|550533692|dbj|BAO01536.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|550533711|dbj|BAO01555.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|550533778|dbj|BAO01620.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|550533797|dbj|BAO01639.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|550533863|dbj|BAO01704.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|550533882|dbj|BAO01723.1| ribosomal protein L23 (chloroplast) [Vitis vinifera subsp. caucasica] gi|555945958|gb|AGZ19185.1| ribosomal protein L23 (chloroplast) [Camellia sinensis] gi|586598727|gb|AHJ61427.1| ribosomal protein L23 [Cucumis hystrix] gi|586598743|gb|AHJ61443.1| ribosomal protein L23 [Cucumis hystrix] Length = 93 Score = 132 bits (333), Expect = 4e-29 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >ref|YP_005296142.1| rpl23 gene product (chloroplast) [Pentactina rupicola] gi|377829934|ref|YP_005296161.1| rpl23 gene product (chloroplast) [Pentactina rupicola] gi|340806942|gb|AEK71570.1| ribosomal protein L23 [Spiraea tomentosa] gi|371532663|gb|AEX31773.1| ribosomal protein L23 (chloroplast) [Pentactina rupicola] gi|371532682|gb|AEX31792.1| ribosomal protein L23 (chloroplast) [Pentactina rupicola] Length = 93 Score = 132 bits (333), Expect = 4e-29 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >gb|AEK71563.1| ribosomal protein L23 [Ruptiliocarpon caracolito] Length = 93 Score = 132 bits (333), Expect = 4e-29 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >gb|AEK71504.1| ribosomal protein L23 [Leea guineensis] Length = 93 Score = 132 bits (333), Expect = 4e-29 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >gb|AEK71491.1| ribosomal protein L23 [Juglans nigra] gi|340807242|gb|AEK71826.1| ribosomal protein L23 [Heisteria concinna] Length = 93 Score = 132 bits (333), Expect = 4e-29 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >gb|AEK71460.1| ribosomal protein L23 [Coriaria nepalensis] Length = 93 Score = 132 bits (333), Expect = 4e-29 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 32 RTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 91 Query: 202 RT 197 RT Sbjct: 92 RT 93 >ref|YP_008081408.1| ribosomal protein L23 (chloroplast) [Tetracentron sinense] gi|511348500|ref|YP_008081428.1| ribosomal protein L23 (chloroplast) [Tetracentron sinense] gi|511348574|ref|YP_008081500.1| ribosomal protein L23 (chloroplast) [Trochodendron aralioides] gi|511348593|ref|YP_008081519.1| ribosomal protein L23 (chloroplast) [Trochodendron aralioides] gi|290487768|gb|ADD30268.1| ribosomal protein L23 [Trochodendron aralioides] gi|340807077|gb|AEK71682.1| ribosomal protein L23 [Trochodendron aralioides] gi|479279246|gb|AGJ72100.1| ribosomal protein L23 (chloroplast) [Tetracentron sinense] gi|479279265|gb|AGJ72119.1| ribosomal protein L23 (chloroplast) [Tetracentron sinense] gi|479279339|gb|AGJ72192.1| ribosomal protein L23 (chloroplast) [Trochodendron aralioides] gi|479279358|gb|AGJ72211.1| ribosomal protein L23 (chloroplast) [Trochodendron aralioides] Length = 95 Score = 132 bits (333), Expect = 4e-29 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -3 Query: 382 RTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 203 RTE+KHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK Sbjct: 34 RTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKK 93 Query: 202 RT 197 RT Sbjct: 94 RT 95