BLASTX nr result
ID: Rehmannia22_contig00040116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00040116 (385 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68163.1| hypothetical protein M569_06603, partial [Genlise... 58 1e-06 >gb|EPS68163.1| hypothetical protein M569_06603, partial [Genlisea aurea] Length = 961 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +1 Query: 265 LTHIVVALLIFLVGGVICFTDPNDFKILNDFRNGLENPDL 384 L H + LLI LVGGV C T+PND +LNDFR GLENPDL Sbjct: 2 LMHHLFGLLILLVGGVECSTNPNDAAVLNDFRKGLENPDL 41