BLASTX nr result
ID: Rehmannia22_contig00040065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00040065 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB29019.1| putative disease resistance RPP8-like protein 2 [... 58 1e-06 ref|XP_006602948.1| PREDICTED: putative disease resistance prote... 57 2e-06 ref|XP_002524239.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >gb|EXB29019.1| putative disease resistance RPP8-like protein 2 [Morus notabilis] Length = 956 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = +3 Query: 162 MAEAVVSIALETLRDLLLEEARFLSGVSKEAKGLEKQLKEIQCLLQDAD 308 MAEA+VS +E L DLLL EA+FLSGV EA+ + +L+ I+C L+DAD Sbjct: 1 MAEAIVSFVIERLGDLLLNEAKFLSGVRNEAEEAKTELQRIKCFLEDAD 49 >ref|XP_006602948.1| PREDICTED: putative disease resistance protein At1g50180-like isoform X1 [Glycine max] gi|571549466|ref|XP_006602949.1| PREDICTED: putative disease resistance protein At1g50180-like isoform X2 [Glycine max] gi|571549469|ref|XP_006602950.1| PREDICTED: putative disease resistance protein At1g50180-like isoform X3 [Glycine max] Length = 919 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +3 Query: 162 MAEAVVSIALETLRDLLLEEARFLSGVSKEAKGLEKQLKEIQCLLQDAD 308 M EAVVS A+E L DLL EEAR L GVS + K ++ +LK +QC L+DA+ Sbjct: 1 MVEAVVSFAVERLHDLLTEEARLLIGVSDKVKRMQNELKRMQCFLRDAE 49 >ref|XP_002524239.1| conserved hypothetical protein [Ricinus communis] gi|223536516|gb|EEF38163.1| conserved hypothetical protein [Ricinus communis] Length = 985 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/49 (53%), Positives = 38/49 (77%) Frame = +3 Query: 162 MAEAVVSIALETLRDLLLEEARFLSGVSKEAKGLEKQLKEIQCLLQDAD 308 MAEA+VS+A++ + LL++EA FLSGV +E L+++LK I C L+DAD Sbjct: 1 MAEAIVSLAIQRINGLLIQEAVFLSGVKEEVTRLQEELKRILCFLKDAD 49