BLASTX nr result
ID: Rehmannia22_contig00039759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00039759 (386 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB83867.1| hypothetical protein L484_023474 [Morus notabilis] 71 2e-10 ref|XP_006339735.1| PREDICTED: uncharacterized protein LOC102589... 70 3e-10 ref|XP_004230000.1| PREDICTED: uncharacterized protein LOC101257... 70 3e-10 ref|XP_004155174.1| PREDICTED: uncharacterized LOC101207141 [Cuc... 69 6e-10 ref|XP_004133802.1| PREDICTED: uncharacterized protein LOC101207... 69 6e-10 gb|EOX95650.1| NC domain-containing protein-related [Theobroma c... 68 1e-09 ref|XP_004240075.1| PREDICTED: uncharacterized protein LOC101248... 68 1e-09 ref|XP_002523304.1| conserved hypothetical protein [Ricinus comm... 68 1e-09 ref|XP_006345546.1| PREDICTED: uncharacterized protein LOC102599... 67 2e-09 ref|XP_006491314.1| PREDICTED: uncharacterized protein LOC102607... 67 2e-09 ref|XP_006444800.1| hypothetical protein CICLE_v10021778mg [Citr... 67 2e-09 ref|NP_563621.1| NC domain-containing protein-like protein [Arab... 67 2e-09 gb|AAM64633.1| unknown [Arabidopsis thaliana] 67 2e-09 ref|XP_006279525.1| hypothetical protein CARUB_v10028051mg [Caps... 67 3e-09 ref|NP_680550.1| NC domain-containing protein-like protein [Arab... 67 3e-09 emb|CBI40583.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|XP_002266683.1| PREDICTED: uncharacterized protein LOC100253... 67 3e-09 ref|NP_001239945.1| uncharacterized protein LOC100797242 [Glycin... 66 4e-09 ref|NP_001236641.1| uncharacterized protein LOC100527481 [Glycin... 66 4e-09 ref|XP_006396322.1| hypothetical protein EUTSA_v10028905mg [Eutr... 66 6e-09 >gb|EXB83867.1| hypothetical protein L484_023474 [Morus notabilis] Length = 258 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTNRVERSEIKPGDHIYTYRA+FAYSHHG Sbjct: 1 MGLLTNRVERSEIKPGDHIYTYRAIFAYSHHG 32 >ref|XP_006339735.1| PREDICTED: uncharacterized protein LOC102589709 [Solanum tuberosum] Length = 254 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTNRV+RSEIKPGDHIYTYRAVFAYSHHG Sbjct: 1 MGLLTNRVDRSEIKPGDHIYTYRAVFAYSHHG 32 >ref|XP_004230000.1| PREDICTED: uncharacterized protein LOC101257602 [Solanum lycopersicum] Length = 254 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTNRV+RSEIKPGDHIYTYRAVFAYSHHG Sbjct: 1 MGLLTNRVDRSEIKPGDHIYTYRAVFAYSHHG 32 >ref|XP_004155174.1| PREDICTED: uncharacterized LOC101207141 [Cucumis sativus] Length = 286 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGL++NRVERSEIKPGDHIYTYRAVFAYSHHG Sbjct: 1 MGLISNRVERSEIKPGDHIYTYRAVFAYSHHG 32 >ref|XP_004133802.1| PREDICTED: uncharacterized protein LOC101207141 [Cucumis sativus] Length = 253 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGL++NRVERSEIKPGDHIYTYRAVFAYSHHG Sbjct: 1 MGLISNRVERSEIKPGDHIYTYRAVFAYSHHG 32 >gb|EOX95650.1| NC domain-containing protein-related [Theobroma cacao] Length = 258 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTNRVER+EIKPGDH+YTYRAVF YSHHG Sbjct: 1 MGLLTNRVERNEIKPGDHVYTYRAVFTYSHHG 32 >ref|XP_004240075.1| PREDICTED: uncharacterized protein LOC101248486 [Solanum lycopersicum] Length = 294 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 136 EREMGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 + +MGLLTNRV R+EIKPGDHIYTYRAVFAYSHHG Sbjct: 37 KEKMGLLTNRVGRNEIKPGDHIYTYRAVFAYSHHG 71 >ref|XP_002523304.1| conserved hypothetical protein [Ricinus communis] gi|223537392|gb|EEF39020.1| conserved hypothetical protein [Ricinus communis] Length = 258 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLL+NRVERSEIKPGDHIYTYRAVF YSHHG Sbjct: 1 MGLLSNRVERSEIKPGDHIYTYRAVFTYSHHG 32 >ref|XP_006345546.1| PREDICTED: uncharacterized protein LOC102599252 isoform X1 [Solanum tuberosum] Length = 256 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTNRV R+EIKPGDHIYTYRAVFAYSHHG Sbjct: 1 MGLLTNRVGRNEIKPGDHIYTYRAVFAYSHHG 32 >ref|XP_006491314.1| PREDICTED: uncharacterized protein LOC102607118 [Citrus sinensis] Length = 259 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTNRVER+EIK GDHIYTYRAVFAYSHHG Sbjct: 1 MGLLTNRVERNEIKAGDHIYTYRAVFAYSHHG 32 >ref|XP_006444800.1| hypothetical protein CICLE_v10021778mg [Citrus clementina] gi|567904626|ref|XP_006444801.1| hypothetical protein CICLE_v10021778mg [Citrus clementina] gi|557547062|gb|ESR58040.1| hypothetical protein CICLE_v10021778mg [Citrus clementina] gi|557547063|gb|ESR58041.1| hypothetical protein CICLE_v10021778mg [Citrus clementina] Length = 259 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTNRVER+EIK GDHIYTYRAVFAYSHHG Sbjct: 1 MGLLTNRVERNEIKAGDHIYTYRAVFAYSHHG 32 >ref|NP_563621.1| NC domain-containing protein-like protein [Arabidopsis thaliana] gi|89001049|gb|ABD59114.1| At1g01225 [Arabidopsis thaliana] gi|332189135|gb|AEE27256.1| NC domain-containing protein-like protein [Arabidopsis thaliana] Length = 260 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTN++ER E+KPGDHIYTYRA+FAYSHHG Sbjct: 1 MGLLTNKIEREELKPGDHIYTYRAIFAYSHHG 32 >gb|AAM64633.1| unknown [Arabidopsis thaliana] Length = 260 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTN++ER E+KPGDHIYTYRA+FAYSHHG Sbjct: 1 MGLLTNKIEREELKPGDHIYTYRAIFAYSHHG 32 >ref|XP_006279525.1| hypothetical protein CARUB_v10028051mg [Capsella rubella] gi|482548229|gb|EOA12423.1| hypothetical protein CARUB_v10028051mg [Capsella rubella] Length = 247 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTN++ER E+KPGDHIYTYRAVFAYSHHG Sbjct: 1 MGLLTNKMEREELKPGDHIYTYRAVFAYSHHG 32 >ref|NP_680550.1| NC domain-containing protein-like protein [Arabidopsis thaliana] gi|332656554|gb|AEE81954.1| NC domain-containing protein-like protein [Arabidopsis thaliana] Length = 263 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MG+LTN+VER E+KPGDHIYTYRAVFAYSHHG Sbjct: 1 MGVLTNKVERDELKPGDHIYTYRAVFAYSHHG 32 >emb|CBI40583.3| unnamed protein product [Vitis vinifera] Length = 140 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTNRVERSEI+PGDHIYT+RAVF YSHHG Sbjct: 1 MGLLTNRVERSEIRPGDHIYTWRAVFTYSHHG 32 >ref|XP_002266683.1| PREDICTED: uncharacterized protein LOC100253490 [Vitis vinifera] gi|147767788|emb|CAN66977.1| hypothetical protein VITISV_022080 [Vitis vinifera] Length = 262 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLLTNRVERSEI+PGDHIYT+RAVF YSHHG Sbjct: 1 MGLLTNRVERSEIRPGDHIYTWRAVFTYSHHG 32 >ref|NP_001239945.1| uncharacterized protein LOC100797242 [Glycine max] gi|255638656|gb|ACU19633.1| unknown [Glycine max] Length = 259 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLL+NRVER EIKPGDHIYTYRAVF YSHHG Sbjct: 1 MGLLSNRVERHEIKPGDHIYTYRAVFTYSHHG 32 >ref|NP_001236641.1| uncharacterized protein LOC100527481 [Glycine max] gi|255632450|gb|ACU16575.1| unknown [Glycine max] Length = 258 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGLL+NRVER EIKPGDHIYTYRAVF YSHHG Sbjct: 1 MGLLSNRVERHEIKPGDHIYTYRAVFTYSHHG 32 >ref|XP_006396322.1| hypothetical protein EUTSA_v10028905mg [Eutrema salsugineum] gi|557097339|gb|ESQ37775.1| hypothetical protein EUTSA_v10028905mg [Eutrema salsugineum] Length = 253 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 145 MGLLTNRVERSEIKPGDHIYTYRAVFAYSHHG 240 MGL+TN+VER E+KPGDHIYTYRAVF+YSHHG Sbjct: 1 MGLITNKVERDELKPGDHIYTYRAVFSYSHHG 32