BLASTX nr result
ID: Rehmannia22_contig00039720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00039720 (374 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527004.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 >ref|XP_002527004.1| conserved hypothetical protein [Ricinus communis] gi|223533639|gb|EEF35376.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/64 (48%), Positives = 43/64 (67%) Frame = +2 Query: 2 KGYGLGVTPTQVNGEHFPLGEKRLNETDSMQKKLTDMQANYEEKILNLTAEYEGKINQLK 181 KGYG+GVTP+Q+ G F + R E D+MQ +L +M A+YE KI NL EYE K+ +K Sbjct: 36 KGYGVGVTPSQLFGSEFRPIKIRQTEMDNMQNELFEMHAHYETKIANLKDEYEWKMANMK 95 Query: 182 EDHE 193 ++E Sbjct: 96 ANYE 99