BLASTX nr result
ID: Rehmannia22_contig00039089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00039089 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS72113.1| hypothetical protein M569_02646, partial [Genlise... 61 2e-07 >gb|EPS72113.1| hypothetical protein M569_02646, partial [Genlisea aurea] Length = 510 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 348 GELPHLRELFLQNNKLNGSIPESLKKKEGLNIR 250 GELP+LRELFLQNNK+NGS+PESLK K G+NIR Sbjct: 478 GELPYLRELFLQNNKINGSLPESLKHKHGINIR 510