BLASTX nr result
ID: Rehmannia22_contig00039065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00039065 (399 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus ... 63 5e-08 ref|XP_002322522.1| F-box family protein [Populus trichocarpa] g... 57 3e-06 >ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527546|gb|EEF29668.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 389 Score = 62.8 bits (151), Expect = 5e-08 Identities = 35/89 (39%), Positives = 50/89 (56%) Frame = -2 Query: 395 RLFSVSAQDNIGAVETLRPIAYLKCKGEVLLQHDKKELVWLNLETKLGKKIRIDGRPTTF 216 +LFSV+ + IG + +L+P+AY K EVL++HD L W +L+ K + I G P TF Sbjct: 284 KLFSVARLEVIGILRSLKPLAYSKSGNEVLIEHDNVNLFWYDLKRKEVVNVWIQGVPITF 343 Query: 215 SSQFCLASLVRLRDIVVDGGFNNAKRLTR 129 ++ C+ SLV L NA RL R Sbjct: 344 EAEICVGSLVPL----------NANRLRR 362 >ref|XP_002322522.1| F-box family protein [Populus trichocarpa] gi|222867152|gb|EEF04283.1| F-box family protein [Populus trichocarpa] Length = 419 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/74 (39%), Positives = 46/74 (62%) Frame = -2 Query: 395 RLFSVSAQDNIGAVETLRPIAYLKCKGEVLLQHDKKELVWLNLETKLGKKIRIDGRPTTF 216 ++FSV IGA LRP+ Y K G+VLL+ + ++LVW + + K K ++I G P ++ Sbjct: 308 KMFSVQGIKWIGAFMFLRPLIYSKDGGKVLLEVNDEKLVWYDWKNKHAKVVKIRGGPNSY 367 Query: 215 SSQFCLASLVRLRD 174 S+ + SLVR+ D Sbjct: 368 GSEMYVESLVRIND 381