BLASTX nr result
ID: Rehmannia22_contig00038973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00038973 (437 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004310089.1| PREDICTED: stress-associated endoplasmic ret... 66 4e-09 gb|EPS64621.1| hypothetical protein M569_10160 [Genlisea aurea] 66 5e-09 gb|ADB02897.1| membrane protein [Jatropha curcas] 66 5e-09 gb|EOX99811.1| Ribosome associated membrane protein RAMP4 [Theob... 65 9e-09 ref|XP_004239220.1| PREDICTED: stress-associated endoplasmic ret... 65 9e-09 ref|XP_004239221.1| PREDICTED: stress-associated endoplasmic ret... 65 1e-08 emb|CBI27668.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002277156.1| PREDICTED: stress-associated endoplasmic ret... 65 1e-08 ref|XP_002514902.1| stress associated endoplasmic reticulum prot... 64 2e-08 gb|EMJ25136.1| hypothetical protein PRUPE_ppa014280mg [Prunus pe... 64 3e-08 gb|EMJ25135.1| hypothetical protein PRUPE_ppa014280mg [Prunus pe... 64 3e-08 ref|XP_003524899.1| PREDICTED: stress-associated endoplasmic ret... 64 3e-08 ref|XP_006415774.1| hypothetical protein EUTSA_v10009276mg [Eutr... 63 5e-08 ref|XP_004310090.1| PREDICTED: stress-associated endoplasmic ret... 63 5e-08 ref|XP_004239222.1| PREDICTED: stress-associated endoplasmic ret... 63 5e-08 gb|AFK48951.1| unknown [Lotus japonicus] 63 5e-08 ref|XP_006352178.1| PREDICTED: stress-associated endoplasmic ret... 62 6e-08 ref|XP_006415776.1| hypothetical protein EUTSA_v10009274mg [Eutr... 62 6e-08 ref|XP_004239223.1| PREDICTED: stress-associated endoplasmic ret... 62 6e-08 gb|AAT38818.1| membrane protein [Brassica juncea] gi|306415491|g... 62 6e-08 >ref|XP_004310089.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like isoform 1 [Fragaria vesca subsp. vesca] Length = 71 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = +2 Query: 41 HIQTTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 ++QTTSRRLA+RKVE+FEKNITKR V ETT KK + PILLGF F Sbjct: 2 NVQTTSRRLADRKVERFEKNITKRGAVPETTAKKGKDYPVGPILLGFFIF 51 >gb|EPS64621.1| hypothetical protein M569_10160 [Genlisea aurea] Length = 69 Score = 65.9 bits (159), Expect = 5e-09 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = +2 Query: 44 IQTTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 +QTTSRRLA+RKVE+FEKNIT+R V ET+TKK +N PILLGF F Sbjct: 1 MQTTSRRLADRKVERFEKNITRRGSVPETSTKKGSNYPVGPILLGFFIF 49 >gb|ADB02897.1| membrane protein [Jatropha curcas] Length = 68 Score = 65.9 bits (159), Expect = 5e-09 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVEKFEKNITKR V ETTTKK + P+LLGF F Sbjct: 2 TTSRRLADRKVEKFEKNITKRGAVPETTTKKAKDYPVGPVLLGFFIF 48 >gb|EOX99811.1| Ribosome associated membrane protein RAMP4 [Theobroma cacao] Length = 68 Score = 65.1 bits (157), Expect = 9e-09 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVEKFEKNITKR V ETTTKK + P+LLGF F Sbjct: 2 TTSRRLADRKVEKFEKNITKRGTVPETTTKKGKDYPVGPLLLGFFIF 48 >ref|XP_004239220.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like isoform 1 [Solanum lycopersicum] Length = 93 Score = 65.1 bits (157), Expect = 9e-09 Identities = 36/68 (52%), Positives = 43/68 (63%), Gaps = 5/68 (7%) Frame = +2 Query: 26 FCVSSHI-----QTTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 FC S QTTSRRLA+RKVE+FEKNITKR V ETT KK + PILLGF F Sbjct: 9 FCCESFFFVAFDQTTSRRLADRKVERFEKNITKRGAVPETTAKKGSQYPVGPILLGFFVF 68 Query: 191 HLLDHVRL 214 ++ ++ Sbjct: 69 VVIGSCKI 76 >ref|XP_004239221.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like isoform 2 [Solanum lycopersicum] Length = 88 Score = 64.7 bits (156), Expect = 1e-08 Identities = 36/60 (60%), Positives = 39/60 (65%), Gaps = 5/60 (8%) Frame = +2 Query: 26 FCVSSHI-----QTTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 FC S QTTSRRLA+RKVE+FEKNITKR V ETT KK + PILLGF F Sbjct: 9 FCCESFFFVAFDQTTSRRLADRKVERFEKNITKRGAVPETTAKKGSQYPVGPILLGFFVF 68 >emb|CBI27668.3| unnamed protein product [Vitis vinifera] Length = 477 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVEKFEKNITKR V ETTTKK ++ P+LLGF F Sbjct: 411 TTSRRLADRKVEKFEKNITKRGSVPETTTKKGSDYPVGPVLLGFFVF 457 >ref|XP_002277156.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Vitis vinifera] Length = 68 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVEKFEKNITKR V ETTTKK ++ P+LLGF F Sbjct: 2 TTSRRLADRKVEKFEKNITKRGSVPETTTKKGSDYPVGPVLLGFFVF 48 >ref|XP_002514902.1| stress associated endoplasmic reticulum protein, putative [Ricinus communis] gi|223545953|gb|EEF47456.1| stress associated endoplasmic reticulum protein, putative [Ricinus communis] Length = 68 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVE+FEKNITKR V ETTTKK + P+LLGF F Sbjct: 2 TTSRRLADRKVERFEKNITKRGTVPETTTKKGKDYPVGPLLLGFFIF 48 >gb|EMJ25136.1| hypothetical protein PRUPE_ppa014280mg [Prunus persica] Length = 68 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/47 (70%), Positives = 35/47 (74%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVEKFEKNITKR V ETT KK + PILLGF F Sbjct: 2 TTSRRLADRKVEKFEKNITKRGAVPETTAKKGKDYPVGPILLGFFVF 48 >gb|EMJ25135.1| hypothetical protein PRUPE_ppa014280mg [Prunus persica] Length = 76 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/47 (70%), Positives = 35/47 (74%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVEKFEKNITKR V ETT KK + PILLGF F Sbjct: 2 TTSRRLADRKVEKFEKNITKRGAVPETTAKKGKDYPVGPILLGFFVF 48 >ref|XP_003524899.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Glycine max] gi|356525170|ref|XP_003531200.1| PREDICTED: stress-associated endoplasmic reticulum protein 2 [Glycine max] gi|255633110|gb|ACU16910.1| unknown [Glycine max] gi|255647454|gb|ACU24191.1| unknown [Glycine max] Length = 68 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVEKFEKNITKR V +TTTKK + P+LLGF F Sbjct: 2 TTSRRLADRKVEKFEKNITKRGFVPDTTTKKGKDYPVGPVLLGFFVF 48 >ref|XP_006415774.1| hypothetical protein EUTSA_v10009276mg [Eutrema salsugineum] gi|557093545|gb|ESQ34127.1| hypothetical protein EUTSA_v10009276mg [Eutrema salsugineum] Length = 68 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTS+RLA+RK+EKF+KNITKR V ETTTKK + PILLGF F Sbjct: 2 TTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFIF 48 >ref|XP_004310090.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like isoform 2 [Fragaria vesca subsp. vesca] Length = 68 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVE+FEKNITKR V ETT KK + PILLGF F Sbjct: 2 TTSRRLADRKVERFEKNITKRGAVPETTAKKGKDYPVGPILLGFFIF 48 >ref|XP_004239222.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like isoform 3 [Solanum lycopersicum] Length = 73 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/55 (58%), Positives = 39/55 (70%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFFHLLDHVRL 214 TTSRRLA+RKVE+FEKNITKR V ETT KK + PILLGF F ++ ++ Sbjct: 2 TTSRRLADRKVERFEKNITKRGAVPETTAKKGSQYPVGPILLGFFVFVVIGSCKI 56 >gb|AFK48951.1| unknown [Lotus japonicus] Length = 68 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVEKFEKNITKR V ETT KK + P+LLGF F Sbjct: 2 TTSRRLADRKVEKFEKNITKRGFVPETTAKKGKDYPVGPVLLGFFVF 48 >ref|XP_006352178.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Solanum tuberosum] Length = 69 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVE+FEKNITKR V ETT KK + PILLGF F Sbjct: 2 TTSRRLADRKVERFEKNITKRGAVPETTAKKGSQYPVGPILLGFFVF 48 >ref|XP_006415776.1| hypothetical protein EUTSA_v10009274mg [Eutrema salsugineum] gi|557093547|gb|ESQ34129.1| hypothetical protein EUTSA_v10009274mg [Eutrema salsugineum] Length = 68 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTS+RLA+RK+EKF+KNITKR V ETTTKK + PILLGF F Sbjct: 2 TTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVF 48 >ref|XP_004239223.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like isoform 4 [Solanum lycopersicum] Length = 68 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTSRRLA+RKVE+FEKNITKR V ETT KK + PILLGF F Sbjct: 2 TTSRRLADRKVERFEKNITKRGAVPETTAKKGSQYPVGPILLGFFVF 48 >gb|AAT38818.1| membrane protein [Brassica juncea] gi|306415491|gb|ADM86710.1| putative RAMP4 family protein [Brassica juncea] Length = 68 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +2 Query: 50 TTSRRLAERKVEKFEKNITKRSVVHETTTKKRNNLSFCPILLGFSFF 190 TTS+RLA+RK+EKF+KNITKR V ETTTKK + PILLGF F Sbjct: 2 TTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVF 48