BLASTX nr result
ID: Rehmannia22_contig00038767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00038767 (462 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621139.1| hypothetical protein MTR_7g009690 [Medicago ... 57 3e-06 ref|XP_003607039.1| hypothetical protein MTR_4g071510 [Medicago ... 57 3e-06 >ref|XP_003621139.1| hypothetical protein MTR_7g009690 [Medicago truncatula] gi|355496154|gb|AES77357.1| hypothetical protein MTR_7g009690 [Medicago truncatula] Length = 194 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 253 VRCGSGTNQAEAGGHVTPGAEEGGE*SPV 339 VRCGSGTNQAEAGGHVTP A+EGGE SPV Sbjct: 44 VRCGSGTNQAEAGGHVTPKADEGGEWSPV 72 >ref|XP_003607039.1| hypothetical protein MTR_4g071510 [Medicago truncatula] gi|355508094|gb|AES89236.1| hypothetical protein MTR_4g071510 [Medicago truncatula] Length = 78 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = -2 Query: 365 AASCMCLSCTGDHSPPSSAPGVTCPPASAWFVPEPH 258 AA C L C GDHSPPSSA GVTCP S WFV EPH Sbjct: 20 AAHCHTL-CIGDHSPPSSASGVTCPTTSTWFVQEPH 54