BLASTX nr result
ID: Rehmannia22_contig00038402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00038402 (378 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [S... 61 7e-08 ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 51 3e-07 >ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] gi|241931727|gb|EES04872.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] Length = 289 Score = 60.8 bits (146), Expect(2) = 7e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 122 YACIFSLDSRIFCFSGGGEQWCLRCSRCPP 211 YAC+F LDSRIFCFSGGGEQ LRC RCPP Sbjct: 239 YACLFRLDSRIFCFSGGGEQCSLRCGRCPP 268 Score = 21.2 bits (43), Expect(2) = 7e-08 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +1 Query: 103 LALDHYLCMY 132 L+LDHY C++ Sbjct: 234 LSLDHYACLF 243 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 50.8 bits (120), Expect(2) = 3e-07 Identities = 31/71 (43%), Positives = 33/71 (46%) Frame = -1 Query: 213 SGGHLLQRKHHCSPPPEKQKIRESRLKIHA*IVV*CQGRRRKLGTEPYEAEVSRTVL*EG 34 +GGHL QRK HCSPPP+KQKIRES Sbjct: 294 TGGHLPQRKLHCSPPPDKQKIRES------------------------------------ 317 Query: 33 SGYLLELRPTT 1 SGYLLELRPTT Sbjct: 318 SGYLLELRPTT 328 Score = 28.9 bits (63), Expect(2) = 3e-07 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 245 PLVRLASERFFRA 207 PLVRLASERFFRA Sbjct: 275 PLVRLASERFFRA 287