BLASTX nr result
ID: Rehmannia22_contig00038369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00038369 (379 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518046.1| ubiquitin-protein ligase, putative [Ricinus ... 57 2e-06 ref|XP_004308706.1| PREDICTED: F-box/kelch-repeat protein At3g06... 57 3e-06 ref|XP_003637128.1| F-box family protein [Medicago truncatula] g... 55 1e-05 ref|XP_003624065.1| F-box protein [Medicago truncatula] gi|35549... 55 1e-05 >ref|XP_002518046.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223542642|gb|EEF44179.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 257 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/111 (29%), Positives = 57/111 (51%), Gaps = 4/111 (3%) Frame = +1 Query: 55 ELPDDLMVKILAMLPLEDILTYRCVCRTWNILISNPNFSSYYAK----NSPYTSIFITXX 222 +LP DL+ +IL+ +P++ ++ ++C+C+TWN LISNP F+ K N+ ++ + Sbjct: 3 KLPQDLITEILSRVPVKPLIRFKCICKTWNSLISNPEFAKLQLKRAKENNNVSNHYRLLL 62 Query: 223 XXXXXXXXXXXXXXNEELSLYSRYISIKPKVPRVVDINSDPWVTIIGSCDG 375 N+++S R +S D N + V I+GSCDG Sbjct: 63 ATWPPQSLDYEAYCNDDISNALRKLSYHAIAK---DPNDNYDVRILGSCDG 110 >ref|XP_004308706.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Fragaria vesca subsp. vesca] Length = 360 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/47 (44%), Positives = 36/47 (76%) Frame = +1 Query: 58 LPDDLMVKILAMLPLEDILTYRCVCRTWNILISNPNFSSYYAKNSPY 198 +PD++M +IL LP+ +L ++CVC++WN LIS+PNF+++ +S Y Sbjct: 15 IPDEIMFEILTRLPVRSLLRFKCVCKSWNSLISSPNFNTHLDASSDY 61 >ref|XP_003637128.1| F-box family protein [Medicago truncatula] gi|355503063|gb|AES84266.1| F-box family protein [Medicago truncatula] Length = 230 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/54 (38%), Positives = 36/54 (66%) Frame = +1 Query: 55 ELPDDLMVKILAMLPLEDILTYRCVCRTWNILISNPNFSSYYAKNSPYTSIFIT 216 +LP + +L LP++ +L +CVCRTWN +IS+P+F+ + + SPY + +T Sbjct: 91 DLPFPIATDVLLRLPIKSVLVCKCVCRTWNTVISDPHFAKVHFERSPYGFLILT 144 >ref|XP_003624065.1| F-box protein [Medicago truncatula] gi|355499080|gb|AES80283.1| F-box protein [Medicago truncatula] Length = 393 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 12/117 (10%) Frame = +1 Query: 61 PDDLMVKILAMLPLEDILTYRCVCRTWNILISNPNFSSYYAKNSPYTSIFITXXXXXXXX 240 P+DL+ ++L++LP++ I+ +RCV +WNILIS+ F ++ K S + F T Sbjct: 10 PNDLITEVLSVLPVKSIIRFRCVSNSWNILISDSTFVKFHLKRSKARNPFFTLITDHFTY 69 Query: 241 XXXXXXXXNEELSLYSRYI------------SIKPKVPRVVDINSDPWVTIIGSCDG 375 +++ S Y R + S V ++N+ I+G+C+G Sbjct: 70 TQGESPYGSDDESEYDRTVVPYSIRSLIENPSFNLTVDPYYELNAKGCSGIVGTCNG 126