BLASTX nr result
ID: Rehmannia22_contig00038296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00038296 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74123.1| hypothetical protein M569_00634 [Genlisea aurea] 58 1e-06 >gb|EPS74123.1| hypothetical protein M569_00634 [Genlisea aurea] Length = 257 Score = 57.8 bits (138), Expect = 1e-06 Identities = 40/93 (43%), Positives = 53/93 (56%), Gaps = 5/93 (5%) Frame = +1 Query: 73 MSSFSLCLPSK-IPLILHHR--FNFGFSGHPLYGRHRSPSHFSLSAS--VAERNPNLEVS 237 MSSFSL PSK IP +L R FNF FS L R+ S SLSA+ + + ++ + Sbjct: 1 MSSFSLRSPSKMIPSVLRSRLYFNF-FSSGCLRVNPRNCSIVSLSAASVAGKSSAGVDFA 59 Query: 238 WNSWDKVAVDDYNGWAITESAPEPVKEKGFRTF 336 W SWD ++ D+YNGW E +P+ GFR F Sbjct: 60 WVSWDGISPDEYNGWDFFEESPD---RNGFRAF 89