BLASTX nr result
ID: Rehmannia22_contig00038102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00038102 (411 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348765.1| PREDICTED: uncharacterized protein LOC102591... 69 7e-10 gb|EXB44975.1| hypothetical protein L484_026566 [Morus notabilis] 62 1e-07 ref|XP_002514521.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 gb|ESW28376.1| hypothetical protein PHAVU_003G281600g [Phaseolus... 56 6e-06 >ref|XP_006348765.1| PREDICTED: uncharacterized protein LOC102591794 [Solanum tuberosum] Length = 151 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/81 (40%), Positives = 48/81 (59%), Gaps = 3/81 (3%) Frame = -2 Query: 392 GNSFRIDVEDFCLVESFRLGCCMDEIESVLEDFSSRGEFAFGSFWGG---EVSSSRSFRS 222 G S R+ +E C CM+E+E VLE+FS +GEFAFGSFWGG +V + + Sbjct: 75 GGSLRVQLESLC---------CMEEVEKVLEEFSQKGEFAFGSFWGGDEEDVLKTERITT 125 Query: 221 CFKEEELDYDDVRYGLMELFG 159 C ++ +DYD L+++FG Sbjct: 126 CIHKQTVDYDVFHTHLIQVFG 146 >gb|EXB44975.1| hypothetical protein L484_026566 [Morus notabilis] Length = 161 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/60 (48%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -2 Query: 335 GCCMDEIESVLEDFSSRGEFAFGSFWGGEVSSSRSF-RSCFKEEELDYDDVRYGLMELFG 159 GCCM E+E V+E+ S +GEF+FGSFW E S+ F SC ++ E D VRY L+++ G Sbjct: 97 GCCMKEVEKVMEELSQKGEFSFGSFWCKEEESAEIFPASCVQKHESDDGFVRYQLIKMVG 156 >ref|XP_002514521.1| conserved hypothetical protein [Ricinus communis] gi|223546125|gb|EEF47627.1| conserved hypothetical protein [Ricinus communis] Length = 216 Score = 58.5 bits (140), Expect = 9e-07 Identities = 35/72 (48%), Positives = 43/72 (59%) Frame = -2 Query: 380 RIDVEDFCLVESFRLGCCMDEIESVLEDFSSRGEFAFGSFWGGEVSSSRSFRSCFKEEEL 201 RI VE F ES G CM +IE VLE+ S RGEFAFGSFWG E S ++EL Sbjct: 140 RIQVEGFH--ESHGRGSCMKDIEGVLEELSQRGEFAFGSFWGREGSEG------VDKQEL 191 Query: 200 DYDDVRYGLMEL 165 D V++ L+E+ Sbjct: 192 DLSLVQFELVEI 203 >gb|ESW28376.1| hypothetical protein PHAVU_003G281600g [Phaseolus vulgaris] Length = 153 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Frame = -2 Query: 380 RIDVED-FCLVESFRLGCCMDEIESVLEDFSSRGEFAFGSFWGGEVSSSRSFRSCFKEEE 204 RID E F E F G CM+E+E ++E+F +GEF FGSFWG E+ + Sbjct: 74 RIDHEQSFRDGEGFSCGGCMEEVEKMMEEFYEKGEFGFGSFWGRELGTCGCGVPAIVNHH 133 Query: 203 LDYDDVRYGLMELFG 159 D + VRY +++L G Sbjct: 134 SDDNFVRYQIIDLVG 148