BLASTX nr result
ID: Rehmannia22_contig00037990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00037990 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ05680.1| hypothetical protein PRUPE_ppa021209mg, partial [... 63 5e-08 gb|EMJ01284.1| hypothetical protein PRUPE_ppa021085mg, partial [... 58 1e-06 >gb|EMJ05680.1| hypothetical protein PRUPE_ppa021209mg, partial [Prunus persica] Length = 124 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/56 (50%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -2 Query: 386 PGRRFNACLHFN-RGGCRFFEWEDPPICRRAKAIIPGLLRKINKLEGEMKKLESEV 222 PGRRF C ++ R GC FFEW DP +C R+K +I GLL+++ K E E +KL+ +V Sbjct: 20 PGRRFWGCANYGVRRGCAFFEWYDPQVCERSKIVICGLLKRLRKEEEENRKLKKKV 75 >gb|EMJ01284.1| hypothetical protein PRUPE_ppa021085mg, partial [Prunus persica] Length = 83 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Frame = -2 Query: 386 PGRRFNACLHFN-RGGCRFFEWEDPPICRRAKAIIPGLLRKINKLEGEMKKLE 231 PGRRF C + R GC FFEW DP +C R+K +I GLL+++ K E K E Sbjct: 31 PGRRFWGCADYEVRRGCAFFEWYDPQVCERSKIVISGLLKRLRKEENRKLKKE 83