BLASTX nr result
ID: Rehmannia22_contig00037838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00037838 (509 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36614.3| unnamed protein product [Vitis vinifera] 56 4e-06 emb|CAN81813.1| hypothetical protein VITISV_020894 [Vitis vinifera] 56 4e-06 >emb|CBI36614.3| unnamed protein product [Vitis vinifera] Length = 392 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%), Gaps = 2/34 (5%) Frame = +1 Query: 412 MDPDY--TLSQAHPESMDLLSHAWCNFAVQTLQP 507 MDPD+ T+S+AHPE+MD LS AWCNFAVQ +QP Sbjct: 1 MDPDFKPTISEAHPETMDFLSRAWCNFAVQAIQP 34 >emb|CAN81813.1| hypothetical protein VITISV_020894 [Vitis vinifera] Length = 417 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%), Gaps = 2/34 (5%) Frame = +1 Query: 412 MDPDY--TLSQAHPESMDLLSHAWCNFAVQTLQP 507 MDPD+ T+S+AHPE+MD LS AWCNFAVQ +QP Sbjct: 26 MDPDFKPTISEAHPETMDFLSRAWCNFAVQAIQP 59