BLASTX nr result
ID: Rehmannia22_contig00037760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00037760 (336 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60933.1| hypothetical protein M569_13864, partial [Genlise... 56 6e-06 >gb|EPS60933.1| hypothetical protein M569_13864, partial [Genlisea aurea] Length = 98 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 109 VIDKLIFDLSADPEDPLKTTDQTRRLGLIVCRGTAV 2 V+D+ I + DPEDPLKTTDQTRRLGLIVCRGTAV Sbjct: 42 VLDEAI-EYLRDPEDPLKTTDQTRRLGLIVCRGTAV 76