BLASTX nr result
ID: Rehmannia22_contig00037388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00037388 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004246310.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 gb|EXB42398.1| hypothetical protein L484_021993 [Morus notabilis] 58 1e-06 ref|XP_002309173.2| pentatricopeptide repeat-containing family p... 58 1e-06 ref|XP_006429524.1| hypothetical protein CICLE_v10013613mg [Citr... 56 4e-06 ref|XP_004305097.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_002265961.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 emb|CAN63706.1| hypothetical protein VITISV_013107 [Vitis vinifera] 55 7e-06 >ref|XP_004246310.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Solanum lycopersicum] Length = 496 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 3/64 (4%) Frame = +2 Query: 167 LHNYYIRKRRKWPIQPYKTQW-DQIFAFRLAKQNFKQSI--RKTKTQLLSDLINSFSAYE 337 ++NY++RKRRKWP+ YKT+W ++ +L+ Q +S R KT LLS L++SFSAYE Sbjct: 27 MNNYFLRKRRKWPLSLYKTKWQEEKLTHQLSMQKLVESTPNRSPKTHLLSILLDSFSAYE 86 Query: 338 GNPT 349 +PT Sbjct: 87 CDPT 90 >gb|EXB42398.1| hypothetical protein L484_021993 [Morus notabilis] Length = 494 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/61 (44%), Positives = 40/61 (65%) Frame = +2 Query: 167 LHNYYIRKRRKWPIQPYKTQWDQIFAFRLAKQNFKQSIRKTKTQLLSDLINSFSAYEGNP 346 L N ++RK R++PI PYKT+W + F A Q K+ + +LLS L+NSF++Y+ NP Sbjct: 8 LTNKFLRKHREFPISPYKTKWHETFNQTQALQTLKRHQNENPNRLLSLLLNSFNSYDCNP 67 Query: 347 T 349 T Sbjct: 68 T 68 >ref|XP_002309173.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550335936|gb|EEE92696.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 490 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 7/65 (10%) Frame = +2 Query: 173 NYYIRKRRKWPIQPYKTQWDQIFAFRLAKQNFKQSIRK-------TKTQLLSDLINSFSA 331 ++++RK RKWP PYK +W +IF + A Q+ KQS K K LLS LI+SFS Sbjct: 11 SFFLRKHRKWPYSPYKARWHRIFNQQQAMQSLKQSALKPPQQESPNKPHLLSSLIHSFSI 70 Query: 332 YEGNP 346 Y+ P Sbjct: 71 YDVEP 75 >ref|XP_006429524.1| hypothetical protein CICLE_v10013613mg [Citrus clementina] gi|557531581|gb|ESR42764.1| hypothetical protein CICLE_v10013613mg [Citrus clementina] Length = 506 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 10/68 (14%) Frame = +2 Query: 173 NYYIRKRRKWPIQPYKTQWDQIFAFRLAKQNFKQSIRKTKTQ----------LLSDLINS 322 N ++RK RKWP+ PYK +W Q + AKQN KQS+ T+ +LS L++S Sbjct: 11 NLHLRKHRKWPLSPYKAKWHQTLDQQQAKQNVKQSLTTPPTKQQQQIPKQPHILSSLLHS 70 Query: 323 FSAYEGNP 346 FS Y P Sbjct: 71 FSIYNCEP 78 >ref|XP_004305097.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 491 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/58 (41%), Positives = 35/58 (60%) Frame = +2 Query: 176 YYIRKRRKWPIQPYKTQWDQIFAFRLAKQNFKQSIRKTKTQLLSDLINSFSAYEGNPT 349 +++RK RKWP+ PY T+W ++F A Q K S LLS LI+SF+ + +PT Sbjct: 13 FFVRKHRKWPVSPYNTKWHKLFNQHQALQTLKHSPLNPPQTLLSTLIHSFNTFNCDPT 70 >ref|XP_002265961.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Vitis vinifera] Length = 505 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 8/65 (12%) Frame = +2 Query: 179 YIRKRRKWPIQPYKTQWDQIFAFRLAKQNFKQSIRK--------TKTQLLSDLINSFSAY 334 ++RKRRKWP+ PYK W + F R A Q K +I + +Q LS LI+SF Y Sbjct: 12 FLRKRRKWPLSPYKATWHETFHHRQAMQTLKNTIANQSPSPQSPSNSQFLSILIDSFRIY 71 Query: 335 EGNPT 349 +PT Sbjct: 72 NSDPT 76 >emb|CAN63706.1| hypothetical protein VITISV_013107 [Vitis vinifera] Length = 390 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 8/65 (12%) Frame = +2 Query: 179 YIRKRRKWPIQPYKTQWDQIFAFRLAKQNFKQSIRK--------TKTQLLSDLINSFSAY 334 ++RKRRKWP+ PYK W + F R A Q K +I + +Q LS LI+SF Y Sbjct: 14 FLRKRRKWPLSPYKATWHETFHHRQAMQTLKNTIANQSPSPQSPSNSQFLSILIDSFRIY 73 Query: 335 EGNPT 349 +PT Sbjct: 74 NSDPT 78