BLASTX nr result
ID: Rehmannia22_contig00037009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00037009 (307 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346848.1| PREDICTED: putative elongation of fatty acid... 83 3e-14 ref|XP_002310199.1| hypothetical protein POPTR_0007s12290g [Popu... 82 6e-14 ref|XP_003538839.1| PREDICTED: elongation of fatty acids protein... 78 1e-12 gb|EOY14677.1| GNS1/SUR4 membrane protein family [Theobroma cacao] 78 1e-12 ref|XP_004232095.1| PREDICTED: putative elongation of fatty acid... 77 2e-12 ref|XP_002533270.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 ref|XP_004234683.1| PREDICTED: putative elongation of fatty acid... 77 3e-12 ref|XP_006473449.1| PREDICTED: elongation of fatty acids protein... 75 7e-12 ref|XP_004157860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 75 7e-12 ref|XP_004141955.1| PREDICTED: uncharacterized protein LOC101205... 75 7e-12 ref|XP_006434926.1| hypothetical protein CICLE_v10002023mg [Citr... 75 1e-11 ref|XP_004512005.1| PREDICTED: putative elongation of fatty acid... 75 1e-11 ref|XP_002869018.1| GNS1/SUR4 membrane family protein [Arabidops... 74 3e-11 ref|NP_195401.1| protein HOS3-1 [Arabidopsis thaliana] gi|400688... 74 3e-11 ref|XP_006338760.1| PREDICTED: putative elongation of fatty acid... 73 4e-11 ref|XP_002510338.1| conserved hypothetical protein [Ricinus comm... 72 6e-11 ref|XP_004300594.1| PREDICTED: uncharacterized protein LOC101294... 72 8e-11 ref|XP_002327078.1| predicted protein [Populus trichocarpa] gi|5... 72 8e-11 ref|XP_006284240.1| hypothetical protein CARUB_v10005402mg [Caps... 71 1e-10 gb|EMJ03479.1| hypothetical protein PRUPE_ppa008998mg [Prunus pe... 71 2e-10 >ref|XP_006346848.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012-like [Solanum tuberosum] Length = 291 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/70 (55%), Positives = 51/70 (72%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKRTXXXXXXXXDDRRFVA 182 GVLLLH+++GGCNGIGAW NSVLNGAILFFFLN+YV+++LE ++R + Sbjct: 233 GVLLLHFLRGGCNGIGAWVLNSVLNGAILFFFLNYYVKLHLE------------EKRKIR 280 Query: 183 EKSELLKDKD 212 ++LKDKD Sbjct: 281 AAKQMLKDKD 290 >ref|XP_002310199.1| hypothetical protein POPTR_0007s12290g [Populus trichocarpa] gi|222853102|gb|EEE90649.1| hypothetical protein POPTR_0007s12290g [Populus trichocarpa] Length = 279 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKR 134 GVL LH++KGGCNGIGAW FNSVLNGAILF FLNFYV+MYL KR Sbjct: 228 GVLSLHFMKGGCNGIGAWWFNSVLNGAILFLFLNFYVKMYLGKR 271 >ref|XP_003538839.1| PREDICTED: elongation of fatty acids protein A-like [Glycine max] Length = 323 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = +3 Query: 6 VLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKR 134 VLLLH++ GGCNGIGAW FNSVLNGAIL FLNFYVRMYL +R Sbjct: 243 VLLLHFLTGGCNGIGAWVFNSVLNGAILLLFLNFYVRMYLARR 285 >gb|EOY14677.1| GNS1/SUR4 membrane protein family [Theobroma cacao] Length = 298 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKR 134 GV+ LH++KGGCNG+GAWGFNSVLNG IL+ FLNFYV+ +L KR Sbjct: 230 GVIFLHFLKGGCNGMGAWGFNSVLNGVILWLFLNFYVKRHLRKR 273 >ref|XP_004232095.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012-like [Solanum lycopersicum] Length = 277 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKR 134 GVLLLH++KGGCNGIGAW FNSVLN AILF FLNFYV+++L+ R Sbjct: 228 GVLLLHFMKGGCNGIGAWLFNSVLNAAILFLFLNFYVKVHLKNR 271 >ref|XP_002533270.1| conserved hypothetical protein [Ricinus communis] gi|223526895|gb|EEF29102.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKR 134 GVLLLH +KGGCNGIGAW FNSVLNGAIL FLNFYV+M+L K+ Sbjct: 234 GVLLLHLMKGGCNGIGAWIFNSVLNGAILLLFLNFYVKMHLAKK 277 >ref|XP_004234683.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012-like [Solanum lycopersicum] Length = 287 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKR 134 GVLLLH ++GGCNGIGAW NSVLN AILFFFLN+YV+++LEK+ Sbjct: 233 GVLLLHLLRGGCNGIGAWILNSVLNAAILFFFLNYYVKLHLEKK 276 >ref|XP_006473449.1| PREDICTED: elongation of fatty acids protein 2-like [Citrus sinensis] Length = 295 Score = 75.5 bits (184), Expect = 7e-12 Identities = 41/74 (55%), Positives = 46/74 (62%), Gaps = 4/74 (5%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKRTXXXXXXXXDDRRFVA 182 GVLLLH +KGGCNGIGAW FNSVLN IL F+NFYV+MYL + D A Sbjct: 228 GVLLLHVLKGGCNGIGAWTFNSVLNAVILLLFMNFYVKMYLRNK-------KIGDASSAA 280 Query: 183 EKSE----LLKDKD 212 E+S LKDKD Sbjct: 281 EQSNGGQMNLKDKD 294 >ref|XP_004157860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229590 [Cucumis sativus] Length = 316 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYL 125 GVLLLH++KGGCNGIGAW FNSVLNGAIL FLNFY++++L Sbjct: 233 GVLLLHFMKGGCNGIGAWSFNSVLNGAILLLFLNFYLKIHL 273 >ref|XP_004141955.1| PREDICTED: uncharacterized protein LOC101205262 [Cucumis sativus] Length = 316 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYL 125 GVLLLH++KGGCNGIGAW FNSVLNGAIL FLNFY++++L Sbjct: 233 GVLLLHFMKGGCNGIGAWSFNSVLNGAILLLFLNFYLKIHL 273 >ref|XP_006434926.1| hypothetical protein CICLE_v10002023mg [Citrus clementina] gi|557537048|gb|ESR48166.1| hypothetical protein CICLE_v10002023mg [Citrus clementina] Length = 295 Score = 74.7 bits (182), Expect = 1e-11 Identities = 41/74 (55%), Positives = 46/74 (62%), Gaps = 4/74 (5%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKRTXXXXXXXXDDRRFVA 182 GVLLLH +KGGCNGIGAW FNSVLN IL F+NFYV+MYL + D A Sbjct: 228 GVLLLHVLKGGCNGIGAWTFNSVLNAVILLLFMNFYVKMYLRNK-------KIGDASSSA 280 Query: 183 EKSE----LLKDKD 212 E+S LKDKD Sbjct: 281 EQSNGGQMNLKDKD 294 >ref|XP_004512005.1| PREDICTED: putative elongation of fatty acids protein 1-like [Cicer arietinum] Length = 279 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKR 134 GVLLLH+ +GGCNGIGAW FNS LN AILF FL FYVR+YL KR Sbjct: 233 GVLLLHFFRGGCNGIGAWVFNSFLNCAILFLFLKFYVRVYLGKR 276 >ref|XP_002869018.1| GNS1/SUR4 membrane family protein [Arabidopsis lyrata subsp. lyrata] gi|297314854|gb|EFH45277.1| GNS1/SUR4 membrane family protein [Arabidopsis lyrata subsp. lyrata] Length = 297 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKR 134 GVL +H KGGCNGIGAWG NSVLNGAIL FLNFYVRM+ R Sbjct: 234 GVLTMHLFKGGCNGIGAWGLNSVLNGAILLLFLNFYVRMHSPMR 277 >ref|NP_195401.1| protein HOS3-1 [Arabidopsis thaliana] gi|4006888|emb|CAB16818.1| putative protein [Arabidopsis thaliana] gi|7270632|emb|CAB80349.1| putative protein [Arabidopsis thaliana] gi|46931232|gb|AAT06420.1| At4g36830 [Arabidopsis thaliana] gi|56381945|gb|AAV85691.1| At4g36830 [Arabidopsis thaliana] gi|332661307|gb|AEE86707.1| GNS1/SUR4 membrane protein [Arabidopsis thaliana] Length = 289 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKR 134 GVL +H KGGCNGIGAWG NSVLNGAIL FLNFYVRM+ R Sbjct: 234 GVLTMHLFKGGCNGIGAWGLNSVLNGAILLLFLNFYVRMHSPMR 277 >ref|XP_006338760.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012-like [Solanum tuberosum] Length = 284 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVR 116 GVLLLH++KGGCNGIGAW FNSVLN AILF FLNFYV+ Sbjct: 228 GVLLLHFMKGGCNGIGAWVFNSVLNAAILFLFLNFYVK 265 >ref|XP_002510338.1| conserved hypothetical protein [Ricinus communis] gi|223551039|gb|EEF52525.1| conserved hypothetical protein [Ricinus communis] Length = 302 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/69 (49%), Positives = 44/69 (63%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKRTXXXXXXXXDDRRFVA 182 GVL LH++KGGCNG+ AWG NSVLNG IL FL FYV+++L KR R + Sbjct: 232 GVLFLHFLKGGCNGMMAWGLNSVLNGVILVLFLRFYVKVHLIKRKASEVSEYESSSRHLY 291 Query: 183 EKSELLKDK 209 SE+ ++K Sbjct: 292 SVSEIEREK 300 >ref|XP_004300594.1| PREDICTED: uncharacterized protein LOC101294269 [Fragaria vesca subsp. vesca] Length = 298 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMY 122 GVL++H++KGGCNGIGAWGFNSVLN IL FLNFYV+++ Sbjct: 228 GVLMMHFMKGGCNGIGAWGFNSVLNAVILLLFLNFYVKIH 267 >ref|XP_002327078.1| predicted protein [Populus trichocarpa] gi|566202367|ref|XP_006375057.1| GNS1/SUR4 membrane family protein [Populus trichocarpa] gi|550323371|gb|ERP52854.1| GNS1/SUR4 membrane family protein [Populus trichocarpa] Length = 303 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/69 (50%), Positives = 40/69 (57%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKRTXXXXXXXXDDRRFVA 182 GVL LH +KGGCNGIGAWGFNS+LN IL FL FY++MY KR R + Sbjct: 233 GVLSLHILKGGCNGIGAWGFNSMLNAMILLLFLKFYLKMYSNKRKGDSLSELKGSSRHLH 292 Query: 183 EKSELLKDK 209 E L K Sbjct: 293 SSLEKLDSK 301 >ref|XP_006284240.1| hypothetical protein CARUB_v10005402mg [Capsella rubella] gi|482552945|gb|EOA17138.1| hypothetical protein CARUB_v10005402mg [Capsella rubella] Length = 289 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/44 (72%), Positives = 34/44 (77%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYLEKR 134 GVL +H KGGCNGIGAWG NSVLNGAIL FL FYVRM+ R Sbjct: 234 GVLTMHLFKGGCNGIGAWGLNSVLNGAILLLFLKFYVRMHSPMR 277 >gb|EMJ03479.1| hypothetical protein PRUPE_ppa008998mg [Prunus persica] Length = 311 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +3 Query: 3 GVLLLHYIKGGCNGIGAWGFNSVLNGAILFFFLNFYVRMYL 125 GVL+LH+++GGCNGIG W FNSVLNG IL FLNFYVR++L Sbjct: 232 GVLMLHFMRGGCNGIGVWVFNSVLNGVILLAFLNFYVRIHL 272