BLASTX nr result
ID: Rehmannia22_contig00037004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00037004 (308 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006363527.1| PREDICTED: TBC1 domain family member 15-like... 55 7e-06 ref|XP_004487596.1| PREDICTED: GTPase-activating protein gyp7-li... 55 1e-05 >ref|XP_006363527.1| PREDICTED: TBC1 domain family member 15-like [Solanum tuberosum] Length = 438 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = +3 Query: 3 SGRFVTAPIISENGEPTQDPIVLQQINLGKEPASLPKENDNDG 131 SGRF++AP+I+E+G+P DPIVLQ++N KEP S+ + +DG Sbjct: 117 SGRFISAPVITEDGDPILDPIVLQELNAAKEPTSVGQVGPSDG 159 >ref|XP_004487596.1| PREDICTED: GTPase-activating protein gyp7-like isoform X1 [Cicer arietinum] Length = 444 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/42 (54%), Positives = 35/42 (83%) Frame = +3 Query: 3 SGRFVTAPIISENGEPTQDPIVLQQINLGKEPASLPKENDND 128 SGRF+T+P+I+E+GEP QDP++L Q N K A+LP++N+N+ Sbjct: 116 SGRFITSPVITEDGEPIQDPMILPQTNPEKGLAALPQDNNNN 157