BLASTX nr result
ID: Rehmannia22_contig00036790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00036790 (468 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002894090.1| invertase/pectin methylesterase inhibitor fa... 55 7e-06 >ref|XP_002894090.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis lyrata subsp. lyrata] gi|297339932|gb|EFH70349.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis lyrata subsp. lyrata] Length = 176 Score = 55.5 bits (132), Expect = 7e-06 Identities = 38/136 (27%), Positives = 61/136 (44%) Frame = +3 Query: 36 ITETVIYKICSQTGNPRLCRLTLIKFQGKPLFPKALENVTKMAKKHAKETAKKIYALYDA 215 IT + + IC +T NP C L P + + A +T KK+ ++ D Sbjct: 26 ITSSEMSTICDKTLNPSFCLKFLNTKFASPNLQALAKTTLDATQARATQTFKKLQSIIDG 85 Query: 216 IKDEKSTLKMRYNKCLKKYESVMTLLNEAKKSLDLAEASNVNLYSSLAVPYVYSCDQDLH 395 D +S K+ Y CL +YES + L EA + L + +N+ S A+ +C D+ Sbjct: 86 GVDPRS--KLAYRSCLDEYESAIGNLEEAFEHLASGDGMGMNMKVSAALDGADTCLDDVK 143 Query: 396 KKPSEDYKVFRDIVSI 443 + S DY V + +I Sbjct: 144 RLRSVDYSVVNNSKAI 159