BLASTX nr result
ID: Rehmannia22_contig00036599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00036599 (424 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73614.1| hypothetical protein M569_01143 [Genlisea aurea] 65 7e-09 ref|XP_006362660.1| PREDICTED: uncharacterized protein At3g49140... 63 4e-08 gb|EOY23344.1| Pentatricopeptide repeat superfamily protein, put... 63 4e-08 gb|EOY23343.1| Pentatricopeptide repeat superfamily protein, put... 63 4e-08 gb|EOY23342.1| Pentatricopeptide repeat superfamily protein, put... 63 4e-08 gb|EOY23341.1| Pentatricopeptide repeat superfamily protein, put... 63 4e-08 gb|EOY23340.1| Pentatricopeptide repeat superfamily protein, put... 63 4e-08 ref|XP_004234194.1| PREDICTED: uncharacterized protein At3g49140... 63 4e-08 ref|XP_002274287.2| PREDICTED: uncharacterized protein At3g49140... 60 3e-07 emb|CBI22631.3| unnamed protein product [Vitis vinifera] 60 3e-07 ref|XP_006588200.1| PREDICTED: uncharacterized protein At3g49140... 60 4e-07 ref|XP_002513639.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_006599546.1| PREDICTED: uncharacterized protein At3g49140... 58 1e-06 gb|ESW24138.1| hypothetical protein PHAVU_004G106100g [Phaseolus... 58 1e-06 ref|XP_004171922.1| PREDICTED: uncharacterized protein At3g49140... 58 1e-06 ref|XP_004140749.1| PREDICTED: uncharacterized protein LOC101209... 58 1e-06 gb|EXC05954.1| hypothetical protein L484_014223 [Morus notabilis] 57 3e-06 ref|XP_006384111.1| hypothetical protein POPTR_0004s07090g [Popu... 57 3e-06 ref|XP_002323951.2| hypothetical protein POPTR_0017s01000g [Popu... 57 3e-06 ref|XP_004308044.1| PREDICTED: uncharacterized protein At3g49140... 56 4e-06 >gb|EPS73614.1| hypothetical protein M569_01143 [Genlisea aurea] Length = 472 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLMFSG VN+E+HENIFWPDLPYVTD Sbjct: 107 VNSKATLMFSGFVNDEVHENIFWPDLPYVTD 137 >ref|XP_006362660.1| PREDICTED: uncharacterized protein At3g49140-like [Solanum tuberosum] Length = 497 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLMFSGVVN E+ ENIFWPDLPY+TD Sbjct: 114 VNSKATLMFSGVVNNEVQENIFWPDLPYITD 144 >gb|EOY23344.1| Pentatricopeptide repeat superfamily protein, putative isoform 5 [Theobroma cacao] Length = 404 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLMF+G++N+E+HENI WPDLPYVTD Sbjct: 132 VNSKATLMFTGIINDEVHENIMWPDLPYVTD 162 >gb|EOY23343.1| Pentatricopeptide repeat superfamily protein, putative isoform 4, partial [Theobroma cacao] Length = 459 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLMF+G++N+E+HENI WPDLPYVTD Sbjct: 132 VNSKATLMFTGIINDEVHENIMWPDLPYVTD 162 >gb|EOY23342.1| Pentatricopeptide repeat superfamily protein, putative isoform 3 [Theobroma cacao] Length = 483 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLMF+G++N+E+HENI WPDLPYVTD Sbjct: 132 VNSKATLMFTGIINDEVHENIMWPDLPYVTD 162 >gb|EOY23341.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] Length = 402 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLMF+G++N+E+HENI WPDLPYVTD Sbjct: 132 VNSKATLMFTGIINDEVHENIMWPDLPYVTD 162 >gb|EOY23340.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 516 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLMF+G++N+E+HENI WPDLPYVTD Sbjct: 132 VNSKATLMFTGIINDEVHENIMWPDLPYVTD 162 >ref|XP_004234194.1| PREDICTED: uncharacterized protein At3g49140-like [Solanum lycopersicum] Length = 497 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLMFSGVVN E+ ENIFWPDLPY+TD Sbjct: 114 VNSKATLMFSGVVNNEVQENIFWPDLPYITD 144 >ref|XP_002274287.2| PREDICTED: uncharacterized protein At3g49140 [Vitis vinifera] Length = 511 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VN+KATLMFS ++N E+HENIFWP+LPYVTD Sbjct: 125 VNNKATLMFSNLINNEVHENIFWPELPYVTD 155 >emb|CBI22631.3| unnamed protein product [Vitis vinifera] Length = 506 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VN+KATLMFS ++N E+HENIFWP+LPYVTD Sbjct: 120 VNNKATLMFSNLINNEVHENIFWPELPYVTD 150 >ref|XP_006588200.1| PREDICTED: uncharacterized protein At3g49140-like [Glycine max] Length = 523 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +3 Query: 285 DFTFETFSVKRFWF*VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 D T T R VNSKATLMFS ++++E HENI WPDLPY+TD Sbjct: 128 DATLTTAETSRTIIEVNSKATLMFSSLISDEFHENIIWPDLPYLTD 173 >ref|XP_002513639.1| conserved hypothetical protein [Ricinus communis] gi|223547547|gb|EEF49042.1| conserved hypothetical protein [Ricinus communis] Length = 461 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLM +G++N++IHENI WPD+PYVTD Sbjct: 70 VNSKATLMLTGLINDDIHENIIWPDVPYVTD 100 >ref|XP_006599546.1| PREDICTED: uncharacterized protein At3g49140-like [Glycine max] Length = 518 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/46 (56%), Positives = 31/46 (67%) Frame = +3 Query: 285 DFTFETFSVKRFWF*VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 D T R VNSKATLMFS ++++E HENI WPDLPY+TD Sbjct: 119 DATLTAAETSRTIIEVNSKATLMFSSLISDEFHENIIWPDLPYLTD 164 >gb|ESW24138.1| hypothetical protein PHAVU_004G106100g [Phaseolus vulgaris] Length = 509 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/46 (56%), Positives = 31/46 (67%) Frame = +3 Query: 285 DFTFETFSVKRFWF*VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 D T R VNSKATLMFS ++++E HENI WPDLPY+TD Sbjct: 113 DATLTAAETSRTIIEVNSKATLMFSSLISDEFHENIIWPDLPYLTD 158 >ref|XP_004171922.1| PREDICTED: uncharacterized protein At3g49140-like, partial [Cucumis sativus] Length = 163 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLMF+G++N+E+ ENI WP+LPYVTD Sbjct: 107 VNSKATLMFAGLINDEVQENIIWPELPYVTD 137 >ref|XP_004140749.1| PREDICTED: uncharacterized protein LOC101209928 [Cucumis sativus] Length = 513 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLMF+G++N+E+ ENI WP+LPYVTD Sbjct: 131 VNSKATLMFAGLINDEVQENIIWPELPYVTD 161 >gb|EXC05954.1| hypothetical protein L484_014223 [Morus notabilis] Length = 506 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKAT+MFS +VN+++HENI WP++PYVTD Sbjct: 124 VNSKATVMFSNLVNDQVHENIIWPEMPYVTD 154 >ref|XP_006384111.1| hypothetical protein POPTR_0004s07090g [Populus trichocarpa] gi|550340505|gb|ERP61908.1| hypothetical protein POPTR_0004s07090g [Populus trichocarpa] Length = 422 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = +3 Query: 315 RFWF*VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 R F SKATLM +GV+N++ HENI WPDLPYVTD Sbjct: 36 RVLFQAKSKATLMLTGVINDDFHENIIWPDLPYVTD 71 >ref|XP_002323951.2| hypothetical protein POPTR_0017s01000g [Populus trichocarpa] gi|550318993|gb|EEF04084.2| hypothetical protein POPTR_0017s01000g [Populus trichocarpa] Length = 482 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 336 SKATLMFSGVVNEEIHENIFWPDLPYVTD 422 SKATLM +GV+N++IHENI WPDLPYVTD Sbjct: 128 SKATLMLTGVINDDIHENIIWPDLPYVTD 156 >ref|XP_004308044.1| PREDICTED: uncharacterized protein At3g49140-like [Fragaria vesca subsp. vesca] Length = 509 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 330 VNSKATLMFSGVVNEEIHENIFWPDLPYVTD 422 VNSKATLMFS ++N+E+HENI PDLPYVTD Sbjct: 131 VNSKATLMFSSMINDEVHENIMCPDLPYVTD 161