BLASTX nr result
ID: Rehmannia22_contig00036528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00036528 (734 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB64612.1| BTB/POZ domain-containing protein [Morus notabilis] 121 3e-25 gb|EOY29029.1| Root phototropism protein, putative isoform 1 [Th... 119 1e-24 ref|XP_002323131.2| hypothetical protein POPTR_0016s00530g [Popu... 116 9e-24 ref|XP_006467218.1| PREDICTED: BTB/POZ domain-containing protein... 115 1e-23 ref|XP_006449993.1| hypothetical protein CICLE_v10014681mg [Citr... 115 1e-23 ref|XP_002525040.1| Root phototropism protein, putative [Ricinus... 115 1e-23 ref|XP_003635037.1| PREDICTED: BTB/POZ domain-containing protein... 114 3e-23 gb|EOY29031.1| Root phototropism protein, putative isoform 3 [Th... 114 3e-23 ref|XP_002308748.2| hypothetical protein POPTR_0006s00490g [Popu... 114 4e-23 gb|EOY29030.1| Root phototropism protein, putative isoform 2 [Th... 114 4e-23 gb|EMJ12579.1| hypothetical protein PRUPE_ppa002800mg [Prunus pe... 112 2e-22 ref|XP_006467216.1| PREDICTED: BTB/POZ domain-containing protein... 110 5e-22 ref|XP_004499337.1| PREDICTED: BTB/POZ domain-containing protein... 110 5e-22 gb|ESW19568.1| hypothetical protein PHAVU_006G136000g [Phaseolus... 107 4e-21 ref|XP_003637604.1| BTB/POZ domain-containing protein [Medicago ... 105 2e-20 ref|XP_003550464.1| PREDICTED: BTB/POZ domain-containing protein... 104 3e-20 ref|XP_003547299.1| PREDICTED: BTB/POZ domain-containing protein... 104 3e-20 ref|XP_003534987.1| PREDICTED: BTB/POZ domain-containing protein... 102 2e-19 ref|XP_003529682.1| PREDICTED: BTB/POZ domain-containing protein... 102 2e-19 ref|XP_004293414.1| PREDICTED: BTB/POZ domain-containing protein... 100 4e-19 >gb|EXB64612.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 794 Score = 121 bits (303), Expect = 3e-25 Identities = 57/74 (77%), Positives = 66/74 (89%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMK+GTR DTFYTEEAVRT+ISDVPSDL+I+INNISY LHK+SL P+CGLLQRL S Sbjct: 1 MKFMKIGTRPDTFYTEEAVRTLISDVPSDLSIQINNISYLLHKFSLFPRCGLLQRLCSDS 60 Query: 692 EDSNNVMLDLHDIP 733 +DS NV ++LHDIP Sbjct: 61 DDSENVTIELHDIP 74 >gb|EOY29029.1| Root phototropism protein, putative isoform 1 [Theobroma cacao] gi|508781776|gb|EOY29032.1| Root phototropism protein, putative isoform 1 [Theobroma cacao] Length = 579 Score = 119 bits (297), Expect = 1e-24 Identities = 56/74 (75%), Positives = 64/74 (86%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMK+GT+ DTFYTEEA RTVISD+PSDLTIRINNI Y LHK+ L+P CGLLQRL S Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICYLLHKFPLVPTCGLLQRLCSDS 60 Query: 692 EDSNNVMLDLHDIP 733 EDS+ V++DLHDIP Sbjct: 61 EDSDIVIIDLHDIP 74 >ref|XP_002323131.2| hypothetical protein POPTR_0016s00530g [Populus trichocarpa] gi|550320485|gb|EEF04892.2| hypothetical protein POPTR_0016s00530g [Populus trichocarpa] Length = 593 Score = 116 bits (290), Expect = 9e-24 Identities = 54/74 (72%), Positives = 64/74 (86%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGTR DTF+TE A R+VISD+PSDL IRINNI++ LH++SL+PKCGLLQRL S Sbjct: 1 MKFMKLGTRPDTFFTENATRSVISDIPSDLVIRINNINFLLHQFSLLPKCGLLQRLCSDS 60 Query: 692 EDSNNVMLDLHDIP 733 EDSN V ++LHDIP Sbjct: 61 EDSNTVTIELHDIP 74 >ref|XP_006467218.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X3 [Citrus sinensis] Length = 595 Score = 115 bits (288), Expect = 1e-23 Identities = 54/74 (72%), Positives = 63/74 (85%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGT+ DTFYTEEA RTVISD PSDL I++NNI Y LHK+ L+PKCGLLQRL S Sbjct: 1 MKFMKLGTKPDTFYTEEATRTVISDAPSDLVIQVNNIRYLLHKFPLLPKCGLLQRLCSDP 60 Query: 692 EDSNNVMLDLHDIP 733 EDS++V ++LHDIP Sbjct: 61 EDSDSVTIELHDIP 74 >ref|XP_006449993.1| hypothetical protein CICLE_v10014681mg [Citrus clementina] gi|557552604|gb|ESR63233.1| hypothetical protein CICLE_v10014681mg [Citrus clementina] Length = 595 Score = 115 bits (288), Expect = 1e-23 Identities = 54/74 (72%), Positives = 63/74 (85%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGT+ DTFYTEEA RTVISD PSDL I++NNI Y LHK+ L+PKCGLLQRL S Sbjct: 1 MKFMKLGTKPDTFYTEEATRTVISDAPSDLVIQVNNIRYLLHKFPLLPKCGLLQRLCSDP 60 Query: 692 EDSNNVMLDLHDIP 733 EDS++V ++LHDIP Sbjct: 61 EDSDSVTIELHDIP 74 >ref|XP_002525040.1| Root phototropism protein, putative [Ricinus communis] gi|223535702|gb|EEF37367.1| Root phototropism protein, putative [Ricinus communis] Length = 591 Score = 115 bits (288), Expect = 1e-23 Identities = 53/74 (71%), Positives = 63/74 (85%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGTR DTFYTEEA R+VISD+PSDL IRINNI+Y LHK+ L+PKCGLLQRL Sbjct: 1 MKFMKLGTRPDTFYTEEATRSVISDIPSDLVIRINNINYLLHKFPLLPKCGLLQRLCPDS 60 Query: 692 EDSNNVMLDLHDIP 733 +DS+ + ++LHDIP Sbjct: 61 DDSSTITIELHDIP 74 >ref|XP_003635037.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Vitis vinifera] gi|297736700|emb|CBI25736.3| unnamed protein product [Vitis vinifera] Length = 593 Score = 114 bits (286), Expect = 3e-23 Identities = 55/74 (74%), Positives = 63/74 (85%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGTR DTFYTEEA RTV SDVPSDL IRINNI+Y LHK+ L+PKCGLLQRL++ Sbjct: 1 MKFMKLGTRPDTFYTEEATRTVSSDVPSDLVIRINNITYLLHKFPLLPKCGLLQRLLTDS 60 Query: 692 EDSNNVMLDLHDIP 733 DS+N ++LHDIP Sbjct: 61 GDSDNDSVELHDIP 74 >gb|EOY29031.1| Root phototropism protein, putative isoform 3 [Theobroma cacao] Length = 580 Score = 114 bits (285), Expect = 3e-23 Identities = 56/75 (74%), Positives = 64/75 (85%), Gaps = 1/75 (1%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAV-RTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVST 688 MKFMK+GT+ DTFYTEEA RTVISD+PSDLTIRINNI Y LHK+ L+P CGLLQRL S Sbjct: 1 MKFMKIGTKPDTFYTEEATSRTVISDIPSDLTIRINNICYLLHKFPLVPTCGLLQRLCSD 60 Query: 689 KEDSNNVMLDLHDIP 733 EDS+ V++DLHDIP Sbjct: 61 SEDSDIVIIDLHDIP 75 >ref|XP_002308748.2| hypothetical protein POPTR_0006s00490g [Populus trichocarpa] gi|550335154|gb|EEE92271.2| hypothetical protein POPTR_0006s00490g [Populus trichocarpa] Length = 561 Score = 114 bits (284), Expect = 4e-23 Identities = 51/74 (68%), Positives = 65/74 (87%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGTRLDTFYTEEA R+V+SD+P+DL I+I+NI+Y LH++SL+PKCGLLQRL + Sbjct: 1 MKFMKLGTRLDTFYTEEATRSVVSDIPNDLVIQISNINYLLHQFSLLPKCGLLQRLCADS 60 Query: 692 EDSNNVMLDLHDIP 733 +DS+ V + LHDIP Sbjct: 61 DDSSTVTIQLHDIP 74 >gb|EOY29030.1| Root phototropism protein, putative isoform 2 [Theobroma cacao] Length = 581 Score = 114 bits (284), Expect = 4e-23 Identities = 56/76 (73%), Positives = 64/76 (84%), Gaps = 2/76 (2%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHK--YSLIPKCGLLQRLVS 685 MKFMK+GT+ DTFYTEEA RTVISD+PSDLTIRINNI Y LHK + L+P CGLLQRL S Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICYLLHKLQFPLVPTCGLLQRLCS 60 Query: 686 TKEDSNNVMLDLHDIP 733 EDS+ V++DLHDIP Sbjct: 61 DSEDSDIVIIDLHDIP 76 >gb|EMJ12579.1| hypothetical protein PRUPE_ppa002800mg [Prunus persica] Length = 632 Score = 112 bits (279), Expect = 2e-22 Identities = 54/74 (72%), Positives = 61/74 (82%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMK+GT+ DTF TEEA RTVISDVPSDL I+INNISY LHK+ L+PKCGLLQRL S Sbjct: 1 MKFMKIGTKPDTFCTEEATRTVISDVPSDLLIQINNISYLLHKFPLVPKCGLLQRLCSDS 60 Query: 692 EDSNNVMLDLHDIP 733 DS V ++LHDIP Sbjct: 61 GDSEKVSIELHDIP 74 >ref|XP_006467216.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Citrus sinensis] gi|568825703|ref|XP_006467217.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X2 [Citrus sinensis] Length = 597 Score = 110 bits (275), Expect = 5e-22 Identities = 54/76 (71%), Positives = 63/76 (82%), Gaps = 2/76 (2%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHK--YSLIPKCGLLQRLVS 685 MKFMKLGT+ DTFYTEEA RTVISD PSDL I++NNI Y LHK + L+PKCGLLQRL S Sbjct: 1 MKFMKLGTKPDTFYTEEATRTVISDAPSDLVIQVNNIRYLLHKLQFPLLPKCGLLQRLCS 60 Query: 686 TKEDSNNVMLDLHDIP 733 EDS++V ++LHDIP Sbjct: 61 DPEDSDSVTIELHDIP 76 >ref|XP_004499337.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Cicer arietinum] gi|502126519|ref|XP_004499338.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X2 [Cicer arietinum] gi|502126522|ref|XP_004499339.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X3 [Cicer arietinum] Length = 605 Score = 110 bits (275), Expect = 5e-22 Identities = 50/74 (67%), Positives = 62/74 (83%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGTR DTFYTE+A RT+ SD+PSDL I+IN+++Y LHK++L+PKCGLLQRL Sbjct: 1 MKFMKLGTRQDTFYTEQATRTLTSDIPSDLVIQINDVTYLLHKFALLPKCGLLQRLCCDS 60 Query: 692 EDSNNVMLDLHDIP 733 DS +V L+LHDIP Sbjct: 61 SDSESVTLELHDIP 74 >gb|ESW19568.1| hypothetical protein PHAVU_006G136000g [Phaseolus vulgaris] Length = 603 Score = 107 bits (267), Expect = 4e-21 Identities = 51/74 (68%), Positives = 60/74 (81%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGTR DTFYTE+A R+V+SDV +DL I+IN +Y LHK SL+PKCGLLQRL S Sbjct: 1 MKFMKLGTRPDTFYTEQATRSVVSDVQADLVIKINETTYLLHKSSLLPKCGLLQRLCSDS 60 Query: 692 EDSNNVMLDLHDIP 733 DS NV L+LHD+P Sbjct: 61 SDSENVPLELHDMP 74 >ref|XP_003637604.1| BTB/POZ domain-containing protein [Medicago truncatula] gi|355503539|gb|AES84742.1| BTB/POZ domain-containing protein [Medicago truncatula] Length = 605 Score = 105 bits (261), Expect = 2e-20 Identities = 47/74 (63%), Positives = 61/74 (82%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGTR DTFYTE+A RT+ S++PSDL I+IN+++Y LHK++L+PKCGLLQRL Sbjct: 1 MKFMKLGTRPDTFYTEQATRTLTSEIPSDLVIQINDVTYLLHKFALLPKCGLLQRLCYDS 60 Query: 692 EDSNNVMLDLHDIP 733 DS + ++LHDIP Sbjct: 61 SDSESFTVELHDIP 74 >ref|XP_003550464.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Glycine max] Length = 583 Score = 104 bits (260), Expect = 3e-20 Identities = 48/74 (64%), Positives = 61/74 (82%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGT+ DTFYTE+A RT+IS++ +DL I+IN+I+Y LHK+ L+PKCGLLQRL Sbjct: 1 MKFMKLGTKADTFYTEQATRTLISEIAADLVIQINDITYLLHKFPLLPKCGLLQRLCYDT 60 Query: 692 EDSNNVMLDLHDIP 733 DS +V L+LHDIP Sbjct: 61 SDSESVSLELHDIP 74 >ref|XP_003547299.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Glycine max] gi|571517987|ref|XP_006597619.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X2 [Glycine max] gi|571517990|ref|XP_006597620.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X3 [Glycine max] gi|571517993|ref|XP_006597621.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X4 [Glycine max] gi|571517997|ref|XP_006597622.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X5 [Glycine max] gi|571518003|ref|XP_006597623.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X6 [Glycine max] gi|571518006|ref|XP_006597624.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X7 [Glycine max] Length = 603 Score = 104 bits (259), Expect = 3e-20 Identities = 48/74 (64%), Positives = 61/74 (82%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGTR DTFY+E+A R+++SD+PSDL I+I + +Y LHK SL+PKCGLL+RL S Sbjct: 1 MKFMKLGTRPDTFYSEQATRSLVSDIPSDLVIKIYDTTYLLHKSSLLPKCGLLRRLCSDS 60 Query: 692 EDSNNVMLDLHDIP 733 DS NV L+LHD+P Sbjct: 61 SDSENVPLELHDMP 74 >ref|XP_003534987.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Glycine max] gi|571475860|ref|XP_006586789.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X2 [Glycine max] gi|571475862|ref|XP_006586790.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X3 [Glycine max] gi|571475864|ref|XP_006586791.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X4 [Glycine max] gi|571475866|ref|XP_006586792.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X5 [Glycine max] gi|571475869|ref|XP_006586793.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X6 [Glycine max] gi|571475871|ref|XP_006586794.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X7 [Glycine max] gi|571475873|ref|XP_006586795.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X8 [Glycine max] Length = 599 Score = 102 bits (253), Expect = 2e-19 Identities = 47/74 (63%), Positives = 60/74 (81%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGTR DTFY+E+A R+++SD+P+DL I+I + +Y LHK SL+PKCGLLQRL S Sbjct: 1 MKFMKLGTRPDTFYSEQATRSLVSDIPADLVIKIYDTTYLLHKSSLLPKCGLLQRLCSDS 60 Query: 692 EDSNNVMLDLHDIP 733 S NV L+LHD+P Sbjct: 61 SGSENVPLELHDMP 74 >ref|XP_003529682.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Glycine max] Length = 585 Score = 102 bits (253), Expect = 2e-19 Identities = 47/74 (63%), Positives = 59/74 (79%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMKLGT+ DTFYTE+A RT+IS++ DL I+IN+I+Y LHK+ L+PKCGLLQR Sbjct: 1 MKFMKLGTKADTFYTEQATRTLISEIVVDLVIQINDITYLLHKFPLLPKCGLLQRFCCDT 60 Query: 692 EDSNNVMLDLHDIP 733 DS +V L+LHDIP Sbjct: 61 SDSESVSLELHDIP 74 >ref|XP_004293414.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Fragaria vesca subsp. vesca] Length = 628 Score = 100 bits (250), Expect = 4e-19 Identities = 47/74 (63%), Positives = 57/74 (77%) Frame = +2 Query: 512 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISYRLHKYSLIPKCGLLQRLVSTK 691 MKFMK+GT+ DTFYTE A R+V SDVPSDL I+INN+SY LHK+ L+PKCGLLQ+L Sbjct: 1 MKFMKIGTKPDTFYTERATRSVASDVPSDLLIQINNVSYLLHKFPLLPKCGLLQQLCCDS 60 Query: 692 EDSNNVMLDLHDIP 733 V ++LHDIP Sbjct: 61 GGPEKVNIELHDIP 74