BLASTX nr result
ID: Rehmannia22_contig00036517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00036517 (366 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006357776.1| PREDICTED: U-box domain-containing protein 4... 55 2e-07 ref|XP_006357777.1| PREDICTED: U-box domain-containing protein 4... 55 2e-07 ref|XP_004231992.1| PREDICTED: U-box domain-containing protein 4... 55 1e-05 ref|XP_004231991.1| PREDICTED: U-box domain-containing protein 4... 55 1e-05 >ref|XP_006357776.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Solanum tuberosum] Length = 389 Score = 54.7 bits (130), Expect(2) = 2e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 213 TIPI*AAKDIRRLIKTLQRYRRHFSDAVEPLVDML 317 T+ + AAK+IRRL KT QRYRRHFS+AV+PLVDML Sbjct: 48 TLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDML 82 Score = 26.2 bits (56), Expect(2) = 2e-07 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +2 Query: 185 QSTLVLLHSDDPNLSGQ 235 Q TL L+HSDDP L Q Sbjct: 36 QQTLFLIHSDDPTLKVQ 52 >ref|XP_006357777.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 [Solanum tuberosum] Length = 373 Score = 54.7 bits (130), Expect(2) = 2e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 213 TIPI*AAKDIRRLIKTLQRYRRHFSDAVEPLVDML 317 T+ + AAK+IRRL KT QRYRRHFS+AV+PLVDML Sbjct: 48 TLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDML 82 Score = 26.2 bits (56), Expect(2) = 2e-07 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +2 Query: 185 QSTLVLLHSDDPNLSGQ 235 Q TL L+HSDDP L Q Sbjct: 36 QQTLFLIHSDDPTLKVQ 52 >ref|XP_004231992.1| PREDICTED: U-box domain-containing protein 4-like isoform 2 [Solanum lycopersicum] Length = 373 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/47 (61%), Positives = 37/47 (78%), Gaps = 4/47 (8%) Frame = +3 Query: 189 QRSCFCIR----TIPI*AAKDIRRLIKTLQRYRRHFSDAVEPLVDML 317 Q++ F I+ T+ + AAK+IRRL KT QRYRRHFS+AV+PLVDML Sbjct: 36 QQTLFLIQSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDML 82 >ref|XP_004231991.1| PREDICTED: U-box domain-containing protein 4-like isoform 1 [Solanum lycopersicum] Length = 389 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/47 (61%), Positives = 37/47 (78%), Gaps = 4/47 (8%) Frame = +3 Query: 189 QRSCFCIR----TIPI*AAKDIRRLIKTLQRYRRHFSDAVEPLVDML 317 Q++ F I+ T+ + AAK+IRRL KT QRYRRHFS+AV+PLVDML Sbjct: 36 QQTLFLIQSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDML 82