BLASTX nr result
ID: Rehmannia22_contig00036491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00036491 (333 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004298715.1| PREDICTED: probable LRR receptor-like serine... 79 6e-13 gb|EXC17821.1| putative LRR receptor-like serine/threonine-prote... 78 1e-12 ref|XP_006363743.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR... 77 3e-12 ref|XP_006477322.1| PREDICTED: probable LRR receptor-like serine... 76 5e-12 ref|XP_006440456.1| hypothetical protein CICLE_v10018802mg [Citr... 76 5e-12 ref|XP_004245688.1| PREDICTED: probable LRR receptor-like serine... 75 7e-12 ref|XP_002299581.2| leucine-rich repeat transmembrane protein ki... 75 9e-12 ref|XP_002509644.1| leucine-rich repeat transmembrane protein ki... 75 1e-11 ref|XP_002275029.2| PREDICTED: probable LRR receptor-like serine... 74 3e-11 emb|CBI23559.3| unnamed protein product [Vitis vinifera] 74 3e-11 gb|EOY24534.1| Leucine-rich repeat protein kinase family protein... 73 3e-11 gb|EOY24532.1| Leucine-rich repeat protein kinase family protein... 73 3e-11 gb|EOY24531.1| Leucine-rich repeat protein kinase family protein... 73 3e-11 ref|XP_004170853.1| PREDICTED: probable LRR receptor-like serine... 72 6e-11 ref|XP_004147984.1| PREDICTED: probable LRR receptor-like serine... 72 6e-11 ref|XP_003611204.1| Protein kinase like protein [Medicago trunca... 72 6e-11 gb|EMJ11576.1| hypothetical protein PRUPE_ppa001194mg [Prunus pe... 72 1e-10 ref|XP_002303543.1| leucine-rich repeat transmembrane protein ki... 71 2e-10 ref|XP_004511633.1| PREDICTED: probable LRR receptor-like serine... 70 3e-10 ref|XP_003538720.1| PREDICTED: probable LRR receptor-like serine... 69 5e-10 >ref|XP_004298715.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g12460-like [Fragaria vesca subsp. vesca] Length = 885 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 LRGF+ENE +QVMKLGLICTSE SRRPSMAEVVQVLES+RNGSE Sbjct: 839 LRGFVENELIQVMKLGLICTSEHPSRRPSMAEVVQVLESIRNGSE 883 >gb|EXC17821.1| putative LRR receptor-like serine/threonine-protein kinase [Morus notabilis] Length = 885 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 LRG +ENE +QVMKLGLICTSE+ SRRPSMAEVVQVLES+RNGSE Sbjct: 839 LRGIVENELIQVMKLGLICTSEVPSRRPSMAEVVQVLESIRNGSE 883 >ref|XP_006363743.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein kinase At1g12460-like [Solanum tuberosum] Length = 923 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNG 203 LRGF ENE +QVMKLGLICTSE++SRRPSMAEVVQVLES+RNG Sbjct: 878 LRGFAENELIQVMKLGLICTSEISSRRPSMAEVVQVLESIRNG 920 >ref|XP_006477322.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g12460-like [Citrus sinensis] Length = 884 Score = 75.9 bits (185), Expect = 5e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNG 203 LRGF ENE +QVMKLGLICTSE+ SRRPSMAEVVQVLES+RNG Sbjct: 839 LRGFAENELIQVMKLGLICTSEVPSRRPSMAEVVQVLESIRNG 881 >ref|XP_006440456.1| hypothetical protein CICLE_v10018802mg [Citrus clementina] gi|557542718|gb|ESR53696.1| hypothetical protein CICLE_v10018802mg [Citrus clementina] Length = 884 Score = 75.9 bits (185), Expect = 5e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNG 203 LRGF ENE +QVMKLGLICTSE+ SRRPSMAEVVQVLES+RNG Sbjct: 839 LRGFAENELIQVMKLGLICTSEVPSRRPSMAEVVQVLESIRNG 881 >ref|XP_004245688.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g12460-like [Solanum lycopersicum] Length = 882 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNG 203 LRG+ ENE +QVMKLGLICTSE++SRRPSMAEVVQVLES+RNG Sbjct: 837 LRGYAENELIQVMKLGLICTSEISSRRPSMAEVVQVLESIRNG 879 >ref|XP_002299581.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550346824|gb|EEE84386.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 928 Score = 75.1 bits (183), Expect = 9e-12 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 LRGF ENE +QVMKLGLICTSE+ SRRPSMAEVVQVLES+R+G E Sbjct: 882 LRGFSENELIQVMKLGLICTSELPSRRPSMAEVVQVLESIRSGVE 926 >ref|XP_002509644.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus communis] gi|223549543|gb|EEF51031.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus communis] Length = 884 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 LRGF ENE +QVMKLGLICTSE+ SRRPSMAEVVQVLES+R+G E Sbjct: 838 LRGFSENELIQVMKLGLICTSEVPSRRPSMAEVVQVLESIRSGVE 882 >ref|XP_002275029.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g12460-like, partial [Vitis vinifera] Length = 491 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 LRGF ENE +QVMKLGLICTSE RRPSMAEV+QVLES+R+GSE Sbjct: 446 LRGFSENELIQVMKLGLICTSETPLRRPSMAEVIQVLESIRSGSE 490 >emb|CBI23559.3| unnamed protein product [Vitis vinifera] Length = 483 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 LRGF ENE +QVMKLGLICTSE RRPSMAEV+QVLES+R+GSE Sbjct: 438 LRGFSENELIQVMKLGLICTSETPLRRPSMAEVIQVLESIRSGSE 482 >gb|EOY24534.1| Leucine-rich repeat protein kinase family protein isoform 4 [Theobroma cacao] Length = 646 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 L GF ENE +QVMKLGLICTSE+ SRRPSMAEVVQVLES+R G E Sbjct: 601 LHGFAENELIQVMKLGLICTSEIPSRRPSMAEVVQVLESIRTGME 645 >gb|EOY24532.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma cacao] Length = 865 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 L GF ENE +QVMKLGLICTSE+ SRRPSMAEVVQVLES+R G E Sbjct: 820 LHGFAENELIQVMKLGLICTSEIPSRRPSMAEVVQVLESIRTGME 864 >gb|EOY24531.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma cacao] gi|508777277|gb|EOY24533.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma cacao] Length = 885 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 L GF ENE +QVMKLGLICTSE+ SRRPSMAEVVQVLES+R G E Sbjct: 840 LHGFAENELIQVMKLGLICTSEIPSRRPSMAEVVQVLESIRTGME 884 >ref|XP_004170853.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g12460-like [Cucumis sativus] Length = 882 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNG 203 LRG ENE +QVMKLGLICTSE+ S+RPSMAEVVQVLES+RNG Sbjct: 837 LRGIAENELIQVMKLGLICTSEIPSKRPSMAEVVQVLESIRNG 879 >ref|XP_004147984.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g12460-like [Cucumis sativus] Length = 882 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNG 203 LRG ENE +QVMKLGLICTSE+ S+RPSMAEVVQVLES+RNG Sbjct: 837 LRGIAENELIQVMKLGLICTSEIPSKRPSMAEVVQVLESIRNG 879 >ref|XP_003611204.1| Protein kinase like protein [Medicago truncatula] gi|355512539|gb|AES94162.1| Protein kinase like protein [Medicago truncatula] Length = 890 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 L+GF+ENE +QVMKLGLICTSE RRPSMAE+VQVLES+R+GSE Sbjct: 844 LQGFVENELIQVMKLGLICTSEDPLRRPSMAEIVQVLESIRDGSE 888 >gb|EMJ11576.1| hypothetical protein PRUPE_ppa001194mg [Prunus persica] Length = 884 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 LR +ENE +QVMKLGLICTSE+ S+RPSMAEV+QVLES+RNG E Sbjct: 839 LRDLVENELIQVMKLGLICTSELPSKRPSMAEVIQVLESIRNGLE 883 >ref|XP_002303543.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|222840975|gb|EEE78522.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 883 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLR 209 LRGF ENE +QVMKLGLICTSE+ SRRPSMAEVVQVLES+R Sbjct: 841 LRGFSENELIQVMKLGLICTSEVPSRRPSMAEVVQVLESIR 881 >ref|XP_004511633.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g12460-like [Cicer arietinum] Length = 889 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 L GF ENE +QVMKLGLICTSE RRPSMAE+VQVLES+RNG E Sbjct: 843 LLGFAENELIQVMKLGLICTSEDPLRRPSMAEIVQVLESIRNGLE 887 >ref|XP_003538720.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g12460-like [Glycine max] Length = 884 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -3 Query: 331 LRGFLENEFMQVMKLGLICTSEMASRRPSMAEVVQVLESLRNGSE 197 L GF ENE +QVM+LGLICTSE RRPSMAEVVQVLES+RNG E Sbjct: 838 LLGFAENELIQVMRLGLICTSEDPLRRPSMAEVVQVLESIRNGLE 882