BLASTX nr result
ID: Rehmannia22_contig00036244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00036244 (370 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAK18842.1| dihydropicolinate synthase (DHDPS) precursor [Ph... 96 4e-18 pdb|3TUU|A Chain A, Structure Of Dihydrodipicolinate Synthase Fr... 94 2e-17 ref|XP_002279840.1| PREDICTED: dihydrodipicolinate synthase 2, c... 94 2e-17 ref|XP_002521713.1| dihydrodipicolinate synthase, putative [Rici... 91 2e-16 gb|EOX96184.1| Dihydrodipicolinate synthase isoform 2 [Theobroma... 90 3e-16 gb|EOX96183.1| Dihydrodipicolinate synthase isoform 1 [Theobroma... 90 3e-16 gb|EXB52672.1| Dihydrodipicolinate synthase 2 [Morus notabilis] 89 8e-16 ref|XP_006290360.1| hypothetical protein CARUB_v10017487mg [Caps... 88 1e-15 gb|EMJ19364.1| hypothetical protein PRUPE_ppa007510mg [Prunus pe... 87 2e-15 ref|XP_006402532.1| hypothetical protein EUTSA_v10006047mg [Eutr... 87 2e-15 ref|NP_182068.1| dihydrodipicolinate synthase [Arabidopsis thali... 87 3e-15 ref|NP_850730.1| dihydrodipicolinate synthase 1 [Arabidopsis tha... 87 3e-15 ref|XP_006294472.1| hypothetical protein CARUB_v10023487mg [Caps... 87 3e-15 gb|AAG28565.1|AF200325_1 dihydrodipicolinate synthase 2 [Arabido... 87 3e-15 ref|NP_191647.1| dihydrodipicolinate synthase 1 [Arabidopsis tha... 87 3e-15 pdb|4DPP|A Chain A, The Structure Of Dihydrodipicolinate Synthas... 87 3e-15 ref|XP_002876588.1| dihydrodipicolinate synthase 1 [Arabidopsis ... 87 3e-15 emb|CAB45642.1| dihydrodipicolinate synthase [Arabidopsis thaliana] 87 3e-15 ref|XP_006397726.1| hypothetical protein EUTSA_v10001510mg [Eutr... 86 4e-15 ref|XP_006397725.1| hypothetical protein EUTSA_v10001510mg [Eutr... 86 4e-15 >emb|CAK18842.1| dihydropicolinate synthase (DHDPS) precursor [Phillyrea latifolia] Length = 78 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPLA+RVEFVNIVKELGRENFVGEKDVQVLD+D+FILIGRY Sbjct: 29 PVFRLPYVPLPLAKRVEFVNIVKELGRENFVGEKDVQVLDDDDFILIGRY 78 >pdb|3TUU|A Chain A, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261064|pdb|3TUU|B Chain B, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261065|pdb|3TUU|C Chain C, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261066|pdb|3TUU|D Chain D, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261067|pdb|3TUU|E Chain E, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261068|pdb|3TUU|F Chain F, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261069|pdb|3TUU|G Chain G, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261070|pdb|3TUU|H Chain H, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|538261131|pdb|4HNN|A Chain A, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261132|pdb|4HNN|B Chain B, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261133|pdb|4HNN|C Chain C, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261134|pdb|4HNN|D Chain D, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261135|pdb|4HNN|E Chain E, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261136|pdb|4HNN|F Chain F, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261137|pdb|4HNN|G Chain G, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261138|pdb|4HNN|H Chain H, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine Length = 346 Score = 93.6 bits (231), Expect = 2e-17 Identities = 43/50 (86%), Positives = 49/50 (98%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPLA+RVEFVNIVKE+GRENFVGEKDV+VLD+D+FIL+GRY Sbjct: 297 PVFRLPYVPLPLAKRVEFVNIVKEIGRENFVGEKDVKVLDDDDFILVGRY 346 >ref|XP_002279840.1| PREDICTED: dihydrodipicolinate synthase 2, chloroplastic [Vitis vinifera] gi|296089164|emb|CBI38867.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 93.6 bits (231), Expect = 2e-17 Identities = 43/50 (86%), Positives = 49/50 (98%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPLA+RVEFVNIVKE+GRENFVGEKDV+VLD+D+FIL+GRY Sbjct: 316 PVFRLPYVPLPLAKRVEFVNIVKEIGRENFVGEKDVKVLDDDDFILVGRY 365 >ref|XP_002521713.1| dihydrodipicolinate synthase, putative [Ricinus communis] gi|223539104|gb|EEF40700.1| dihydrodipicolinate synthase, putative [Ricinus communis] Length = 367 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/50 (84%), Positives = 48/50 (96%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPLA+RVEFVN+VK +GRENFVGEKDV+VLD+D+FILIGRY Sbjct: 318 PVFRLPYVPLPLAQRVEFVNLVKAIGRENFVGEKDVRVLDDDDFILIGRY 367 >gb|EOX96184.1| Dihydrodipicolinate synthase isoform 2 [Theobroma cacao] Length = 366 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/50 (80%), Positives = 48/50 (96%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPLA+RVEFVN+V+++GR+NFVGEKDVQVLD D+FIL+GRY Sbjct: 317 PVFRLPYVPLPLAKRVEFVNLVRQIGRQNFVGEKDVQVLDNDDFILVGRY 366 >gb|EOX96183.1| Dihydrodipicolinate synthase isoform 1 [Theobroma cacao] Length = 365 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/50 (80%), Positives = 48/50 (96%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPLA+RVEFVN+V+++GR+NFVGEKDVQVLD D+FIL+GRY Sbjct: 316 PVFRLPYVPLPLAKRVEFVNLVRQIGRQNFVGEKDVQVLDNDDFILVGRY 365 >gb|EXB52672.1| Dihydrodipicolinate synthase 2 [Morus notabilis] Length = 365 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/50 (80%), Positives = 48/50 (96%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPLA+RVEFVN+VK++GRENFVGEKDV+VLD+D+FIL+ RY Sbjct: 316 PVFRLPYVPLPLAKRVEFVNLVKKIGRENFVGEKDVKVLDDDDFILVDRY 365 >ref|XP_006290360.1| hypothetical protein CARUB_v10017487mg [Capsella rubella] gi|482559067|gb|EOA23258.1| hypothetical protein CARUB_v10017487mg [Capsella rubella] Length = 365 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/50 (78%), Positives = 48/50 (96%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPL++R+EFV +VKE+GRE+FVGE+DVQVLD+D+FILIGRY Sbjct: 316 PVFRLPYVPLPLSKRIEFVKLVKEIGREHFVGERDVQVLDDDDFILIGRY 365 >gb|EMJ19364.1| hypothetical protein PRUPE_ppa007510mg [Prunus persica] Length = 365 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/50 (76%), Positives = 48/50 (96%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPLA+RVEFVN+V+++GRENFVGEKDV+VLD+D+F+L+ RY Sbjct: 316 PVFRLPYVPLPLAKRVEFVNLVEQIGRENFVGEKDVKVLDDDDFVLVSRY 365 >ref|XP_006402532.1| hypothetical protein EUTSA_v10006047mg [Eutrema salsugineum] gi|557103631|gb|ESQ43985.1| hypothetical protein EUTSA_v10006047mg [Eutrema salsugineum] Length = 365 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/50 (78%), Positives = 48/50 (96%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LP+++RVEFV +VKE+GRE+FVGE+DVQVLD+D+FILIGRY Sbjct: 316 PVFRLPYVPLPVSKRVEFVKLVKEIGREHFVGERDVQVLDDDDFILIGRY 365 >ref|NP_182068.1| dihydrodipicolinate synthase [Arabidopsis thaliana] gi|14547964|sp|Q9FVC8.2|DAPA2_ARATH RecName: Full=4-hydroxy-tetrahydrodipicolinate synthase 2, chloroplastic; Short=HTPA synthase 2; Flags: Precursor gi|2583111|gb|AAB82620.1| putative dihydrodipicolinate synthase [Arabidopsis thaliana] gi|28466961|gb|AAO44089.1| At2g45440 [Arabidopsis thaliana] gi|110735769|dbj|BAE99862.1| putative dihydrodipicolinate synthase [Arabidopsis thaliana] gi|330255460|gb|AEC10554.1| dihydrodipicolinate synthase [Arabidopsis thaliana] Length = 365 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPL++R+EFV +VKE+GRE+FVGEKDVQ LD+D+FILIGRY Sbjct: 316 PVFRLPYVPLPLSKRLEFVKLVKEIGREHFVGEKDVQALDDDDFILIGRY 365 >ref|NP_850730.1| dihydrodipicolinate synthase 1 [Arabidopsis thaliana] gi|38503407|sp|Q9LZX6.2|DAPA1_ARATH RecName: Full=4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic; Short=HTPA synthase 1; Flags: Precursor gi|17380974|gb|AAL36299.1| putative dihydrodipicolinate synthase precursor [Arabidopsis thaliana] gi|20465357|gb|AAM20082.1| putative dihydrodipicolinate synthase precursor [Arabidopsis thaliana] gi|332646600|gb|AEE80121.1| dihydrodipicolinate synthase 1 [Arabidopsis thaliana] Length = 365 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/50 (76%), Positives = 48/50 (96%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPL++R+EFV +VKE+GRE+FVG++DVQVLD+D+FILIGRY Sbjct: 316 PVFRLPYVPLPLSKRIEFVKLVKEIGREHFVGDRDVQVLDDDDFILIGRY 365 >ref|XP_006294472.1| hypothetical protein CARUB_v10023487mg [Capsella rubella] gi|482563180|gb|EOA27370.1| hypothetical protein CARUB_v10023487mg [Capsella rubella] Length = 365 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPL++R+EFV +VKE+GRE+FVGEKDVQ LD+D+FILIGRY Sbjct: 316 PVFRLPYVPLPLSKRLEFVKLVKEIGREHFVGEKDVQALDDDDFILIGRY 365 >gb|AAG28565.1|AF200325_1 dihydrodipicolinate synthase 2 [Arabidopsis thaliana] Length = 365 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPL++R+EFV +VKE+GRE+FVGEKDVQ LD+D+FILIGRY Sbjct: 316 PVFRLPYVPLPLSKRLEFVKLVKEIGREHFVGEKDVQALDDDDFILIGRY 365 >ref|NP_191647.1| dihydrodipicolinate synthase 1 [Arabidopsis thaliana] gi|7329698|emb|CAB82692.1| dihydrodipicolinate synthase precursor [Arabidopsis thaliana] gi|21593306|gb|AAM65255.1| Dihydrodipicolinate synthase 1, chloroplast precursor (DHDPS 1) [Arabidopsis thaliana] gi|332646599|gb|AEE80120.1| dihydrodipicolinate synthase 1 [Arabidopsis thaliana] Length = 364 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/50 (76%), Positives = 48/50 (96%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPL++R+EFV +VKE+GRE+FVG++DVQVLD+D+FILIGRY Sbjct: 315 PVFRLPYVPLPLSKRIEFVKLVKEIGREHFVGDRDVQVLDDDDFILIGRY 364 >pdb|4DPP|A Chain A, The Structure Of Dihydrodipicolinate Synthase 2 From Arabidopsis Thaliana gi|395759382|pdb|4DPP|B Chain B, The Structure Of Dihydrodipicolinate Synthase 2 From Arabidopsis Thaliana gi|395759383|pdb|4DPQ|A Chain A, The Structure Of Dihydrodipicolinate Synthase 2 From Arabidopsis Thaliana In Complex With (s)-lysine gi|395759384|pdb|4DPQ|B Chain B, The Structure Of Dihydrodipicolinate Synthase 2 From Arabidopsis Thaliana In Complex With (s)-lysine Length = 360 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPL++R+EFV +VKE+GRE+FVGEKDVQ LD+D+FILIGRY Sbjct: 311 PVFRLPYVPLPLSKRLEFVKLVKEIGREHFVGEKDVQALDDDDFILIGRY 360 >ref|XP_002876588.1| dihydrodipicolinate synthase 1 [Arabidopsis lyrata subsp. lyrata] gi|297322426|gb|EFH52847.1| dihydrodipicolinate synthase 1 [Arabidopsis lyrata subsp. lyrata] Length = 365 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/50 (76%), Positives = 48/50 (96%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPL++R+EFV +VKE+GRE+FVG++DVQVLD+D+FILIGRY Sbjct: 316 PVFRLPYVPLPLSKRIEFVRLVKEIGREHFVGDRDVQVLDDDDFILIGRY 365 >emb|CAB45642.1| dihydrodipicolinate synthase [Arabidopsis thaliana] Length = 364 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/50 (76%), Positives = 48/50 (96%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPL++R+EFV +VKE+GRE+FVG++DVQVLD+D+FILIGRY Sbjct: 315 PVFRLPYVPLPLSKRIEFVKLVKEIGREHFVGDRDVQVLDDDDFILIGRY 364 >ref|XP_006397726.1| hypothetical protein EUTSA_v10001510mg [Eutrema salsugineum] gi|557098799|gb|ESQ39179.1| hypothetical protein EUTSA_v10001510mg [Eutrema salsugineum] Length = 365 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPL++R+EFV +VKE+GRE+FVGEKDVQ LD+D+FILIGRY Sbjct: 316 PVFRLPYVPLPLSKRLEFVKMVKEIGREHFVGEKDVQALDDDDFILIGRY 365 >ref|XP_006397725.1| hypothetical protein EUTSA_v10001510mg [Eutrema salsugineum] gi|557098798|gb|ESQ39178.1| hypothetical protein EUTSA_v10001510mg [Eutrema salsugineum] Length = 364 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = +1 Query: 1 PVFRLPYVHLPLARRVEFVNIVKELGRENFVGEKDVQVLDEDEFILIGRY 150 PVFRLPYV LPL++R+EFV +VKE+GRE+FVGEKDVQ LD+D+FILIGRY Sbjct: 315 PVFRLPYVPLPLSKRLEFVKMVKEIGREHFVGEKDVQALDDDDFILIGRY 364