BLASTX nr result
ID: Rehmannia22_contig00036185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00036185 (431 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC31351.1| putative inactive leucine-rich repeat receptor-li... 42 5e-06 >gb|EXC31351.1| putative inactive leucine-rich repeat receptor-like protein kinase [Morus notabilis] Length = 770 Score = 41.6 bits (96), Expect(2) = 5e-06 Identities = 27/60 (45%), Positives = 34/60 (56%), Gaps = 22/60 (36%) Frame = -1 Query: 350 KIVDPIMLSTRSQESLTTVLS----------------------LPYAAQVQTTSDADMRS 237 KIVDPI+L+T SQESL+ V+S L YAAQVQ+T+DAD +S Sbjct: 705 KIVDPIVLTTCSQESLSIVVSITKKCISPEHSSRPSFEDVLWNLHYAAQVQSTADADQKS 764 Score = 34.3 bits (77), Expect(2) = 5e-06 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -2 Query: 430 GHTIRGEEESFLLNEMTSFSSQDD 359 G + G+ E+FLLNEMTSF SQD+ Sbjct: 679 GPIVSGKGETFLLNEMTSFGSQDN 702