BLASTX nr result
ID: Rehmannia22_contig00036120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00036120 (394 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306001.2| glycoside hydrolase family 47 family protein... 60 2e-07 gb|EMJ15733.1| hypothetical protein PRUPE_ppa002795mg [Prunus pe... 60 4e-07 ref|XP_001763064.1| predicted protein [Physcomitrella patens] gi... 59 7e-07 ref|XP_006467474.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 58 1e-06 ref|XP_006303170.1| hypothetical protein CARUB_v10008589mg [Caps... 58 1e-06 ref|XP_002893595.1| glycoside hydrolase family 47 protein [Arabi... 58 1e-06 ref|XP_002519694.1| endoplasmic reticulum mannosyl-oligosacchari... 58 1e-06 gb|EST04831.1| 1, 2-alpha-mannosidase [Pseudozyma sp. GHG001] 57 2e-06 ref|XP_006415522.1| hypothetical protein EUTSA_v10007084mg [Eutr... 57 2e-06 ref|NP_727407.1| alpha mannosidase I, isoform J [Drosophila mela... 57 3e-06 ref|NP_511105.2| alpha mannosidase I, isoform K [Drosophila mela... 57 3e-06 ref|NP_727408.2| alpha mannosidase I, isoform I [Drosophila mela... 57 3e-06 ref|XP_001352253.2| GA17071 [Drosophila pseudoobscura pseudoobsc... 57 3e-06 ref|XP_002101817.1| GE15405 [Drosophila yakuba] gi|194189341|gb|... 57 3e-06 ref|XP_002070893.1| GK25495 [Drosophila willistoni] gi|194166978... 57 3e-06 ref|XP_002055099.1| GJ18983 [Drosophila virilis] gi|194149609|gb... 57 3e-06 ref|XP_002041850.1| GM11326 [Drosophila sechellia] gi|194123655|... 57 3e-06 ref|XP_002024557.1| GL15936 [Drosophila persimilis] gi|194107955... 57 3e-06 ref|XP_002009647.1| GI15126 [Drosophila mojavensis] gi|193908097... 57 3e-06 ref|XP_001977252.1| GG18934 [Drosophila erecta] gi|190648901|gb|... 57 3e-06 >ref|XP_002306001.2| glycoside hydrolase family 47 family protein [Populus trichocarpa] gi|550340952|gb|EEE86512.2| glycoside hydrolase family 47 family protein [Populus trichocarpa] Length = 631 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 297 KY YLLFGDR V+PL++YVFNTEAHPLPI+G+ Sbjct: 600 KYFYLLFGDRSVIPLDKYVFNTEAHPLPIKGS 631 >gb|EMJ15733.1| hypothetical protein PRUPE_ppa002795mg [Prunus persica] Length = 633 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGR 288 KYLYLLFGD VLPL+++VFNTEAHP+P+ GT R Sbjct: 598 KYLYLLFGDSSVLPLDKFVFNTEAHPIPVEGTTKR 632 >ref|XP_001763064.1| predicted protein [Physcomitrella patens] gi|162685876|gb|EDQ72269.1| predicted protein [Physcomitrella patens] Length = 683 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIR 303 KYLYLLFGD +VLPL E+VFNTEAHPLPIR Sbjct: 597 KYLYLLFGDSNVLPLTEFVFNTEAHPLPIR 626 >ref|XP_006467474.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3-like isoform X1 [Citrus sinensis] gi|568826228|ref|XP_006467475.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3-like isoform X2 [Citrus sinensis] Length = 625 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 297 KYLYLLFGD V+PL+++VFN+EAHP PIRGT Sbjct: 593 KYLYLLFGDSSVIPLDQFVFNSEAHPFPIRGT 624 >ref|XP_006303170.1| hypothetical protein CARUB_v10008589mg [Capsella rubella] gi|482571881|gb|EOA36068.1| hypothetical protein CARUB_v10008589mg [Capsella rubella] Length = 623 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 297 KYLYLLFGD V+PL+++VFNTEAHPLPIR T Sbjct: 592 KYLYLLFGDDSVIPLDKFVFNTEAHPLPIRNT 623 >ref|XP_002893595.1| glycoside hydrolase family 47 protein [Arabidopsis lyrata subsp. lyrata] gi|297339437|gb|EFH69854.1| glycoside hydrolase family 47 protein [Arabidopsis lyrata subsp. lyrata] Length = 623 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 297 KYLYLLFGD V+PL+++VFNTEAHPLPIR T Sbjct: 592 KYLYLLFGDDSVIPLDKFVFNTEAHPLPIRNT 623 >ref|XP_002519694.1| endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase, putative [Ricinus communis] gi|223541111|gb|EEF42667.1| endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase, putative [Ricinus communis] Length = 622 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 297 KYLYLLFGD ++PL+++VFNTEAHP PI+GT Sbjct: 591 KYLYLLFGDSSIIPLDKFVFNTEAHPFPIKGT 622 >gb|EST04831.1| 1, 2-alpha-mannosidase [Pseudozyma sp. GHG001] Length = 559 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPI 306 KYLYLLFGDRD LPLN++V NTEAHPLP+ Sbjct: 521 KYLYLLFGDRDTLPLNKWVLNTEAHPLPV 549 >ref|XP_006415522.1| hypothetical protein EUTSA_v10007084mg [Eutrema salsugineum] gi|557093293|gb|ESQ33875.1| hypothetical protein EUTSA_v10007084mg [Eutrema salsugineum] Length = 620 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 297 KYLYLLFGD V+PL+++VFNTEAHPLPIR T Sbjct: 589 KYLYLLFGDDSVIPLDKFVFNTEAHPLPIRTT 620 >ref|NP_727407.1| alpha mannosidase I, isoform J [Drosophila melanogaster] gi|45554685|ref|NP_996395.1| alpha mannosidase I, isoform H [Drosophila melanogaster] gi|45554697|ref|NP_996396.1| alpha mannosidase I, isoform O [Drosophila melanogaster] gi|45554711|ref|NP_996397.1| alpha mannosidase I, isoform N [Drosophila melanogaster] gi|45554725|ref|NP_996398.1| alpha mannosidase I, isoform M [Drosophila melanogaster] gi|45554736|ref|NP_996399.1| alpha mannosidase I, isoform L [Drosophila melanogaster] gi|45645025|sp|P53624.2|MA121_DROME RecName: Full=Mannosyl-oligosaccharide alpha-1,2-mannosidase isoform A; AltName: Full=Man(9)-alpha-mannosidase; AltName: Full=Mannosidase-1 gi|7291136|gb|AAF46570.1| alpha mannosidase I, isoform J [Drosophila melanogaster] gi|39752629|gb|AAR30196.1| RE43942p [Drosophila melanogaster] gi|45446895|gb|AAS65302.1| alpha mannosidase I, isoform L [Drosophila melanogaster] gi|45446896|gb|AAS65303.1| alpha mannosidase I, isoform M [Drosophila melanogaster] gi|45446897|gb|AAS65304.1| alpha mannosidase I, isoform N [Drosophila melanogaster] gi|45446898|gb|AAS65305.1| alpha mannosidase I, isoform O [Drosophila melanogaster] gi|45446899|gb|AAS65306.1| alpha mannosidase I, isoform H [Drosophila melanogaster] Length = 667 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 300 KYLYLLF D VLPL+E+VFNTEAHPLPI+G Sbjct: 619 KYLYLLFSDDSVLPLDEWVFNTEAHPLPIKG 649 >ref|NP_511105.2| alpha mannosidase I, isoform K [Drosophila melanogaster] gi|442615769|ref|NP_001259402.1| alpha mannosidase I, isoform P [Drosophila melanogaster] gi|45645028|sp|P53625.2|MA122_DROME RecName: Full=Mannosyl-oligosaccharide alpha-1,2-mannosidase isoform B; AltName: Full=Man(9)-alpha-mannosidase; AltName: Full=Mannosidase-1 gi|22832018|gb|AAF46571.3| alpha mannosidase I, isoform K [Drosophila melanogaster] gi|440216609|gb|AGB95245.1| alpha mannosidase I, isoform P [Drosophila melanogaster] Length = 643 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 300 KYLYLLF D VLPL+E+VFNTEAHPLPI+G Sbjct: 595 KYLYLLFSDDSVLPLDEWVFNTEAHPLPIKG 625 >ref|NP_727408.2| alpha mannosidase I, isoform I [Drosophila melanogaster] gi|85861129|gb|ABC86513.1| GH09342p [Drosophila melanogaster] gi|220901725|gb|AAN09256.2| alpha mannosidase I, isoform I [Drosophila melanogaster] Length = 684 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 300 KYLYLLF D VLPL+E+VFNTEAHPLPI+G Sbjct: 636 KYLYLLFSDDSVLPLDEWVFNTEAHPLPIKG 666 >ref|XP_001352253.2| GA17071 [Drosophila pseudoobscura pseudoobscura] gi|198142594|gb|EAL29254.2| GA17071 [Drosophila pseudoobscura pseudoobscura] Length = 461 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 300 KYLYLLF D VLPL+E+VFNTEAHPLPI+G Sbjct: 413 KYLYLLFSDDSVLPLDEWVFNTEAHPLPIKG 443 >ref|XP_002101817.1| GE15405 [Drosophila yakuba] gi|194189341|gb|EDX02925.1| GE15405 [Drosophila yakuba] Length = 669 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 300 KYLYLLF D VLPL+E+VFNTEAHPLPI+G Sbjct: 621 KYLYLLFSDDSVLPLDEWVFNTEAHPLPIKG 651 >ref|XP_002070893.1| GK25495 [Drosophila willistoni] gi|194166978|gb|EDW81879.1| GK25495 [Drosophila willistoni] Length = 665 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 300 KYLYLLF D VLPL+E+VFNTEAHPLPI+G Sbjct: 610 KYLYLLFSDDSVLPLDEWVFNTEAHPLPIKG 640 >ref|XP_002055099.1| GJ18983 [Drosophila virilis] gi|194149609|gb|EDW65300.1| GJ18983 [Drosophila virilis] Length = 655 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 300 KYLYLLF D VLPL+E+VFNTEAHPLPI+G Sbjct: 607 KYLYLLFSDDSVLPLDEWVFNTEAHPLPIKG 637 >ref|XP_002041850.1| GM11326 [Drosophila sechellia] gi|194123655|gb|EDW45698.1| GM11326 [Drosophila sechellia] Length = 647 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 300 KYLYLLF D VLPL+E+VFNTEAHPLPI+G Sbjct: 599 KYLYLLFSDDSVLPLDEWVFNTEAHPLPIKG 629 >ref|XP_002024557.1| GL15936 [Drosophila persimilis] gi|194107955|gb|EDW29998.1| GL15936 [Drosophila persimilis] Length = 667 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 300 KYLYLLF D VLPL+E+VFNTEAHPLPI+G Sbjct: 619 KYLYLLFSDDSVLPLDEWVFNTEAHPLPIKG 649 >ref|XP_002009647.1| GI15126 [Drosophila mojavensis] gi|193908097|gb|EDW06964.1| GI15126 [Drosophila mojavensis] Length = 656 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 300 KYLYLLF D VLPL+E+VFNTEAHPLPI+G Sbjct: 608 KYLYLLFSDDSVLPLDEWVFNTEAHPLPIKG 638 >ref|XP_001977252.1| GG18934 [Drosophila erecta] gi|190648901|gb|EDV46179.1| GG18934 [Drosophila erecta] Length = 641 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 392 KYLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 300 KYLYLLF D VLPL+E+VFNTEAHPLPI+G Sbjct: 593 KYLYLLFSDDSVLPLDEWVFNTEAHPLPIKG 623