BLASTX nr result
ID: Rehmannia22_contig00035694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00035694 (318 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273700.1| PREDICTED: reticulon-like protein B12 [Vitis... 76 4e-12 emb|CAN64200.1| hypothetical protein VITISV_014341 [Vitis vinifera] 74 2e-11 ref|XP_006480947.1| PREDICTED: reticulon-like protein B12-like [... 72 8e-11 ref|XP_006429275.1| hypothetical protein CICLE_v10012753mg [Citr... 72 8e-11 gb|EXB89964.1| Reticulon-like protein [Morus notabilis] 70 3e-10 gb|EOY07311.1| Reticulon family protein isoform 3 [Theobroma cacao] 67 3e-09 gb|EOY07310.1| Reticulon family protein isoform 2 [Theobroma cacao] 67 3e-09 gb|EOY07309.1| Reticulon family protein isoform 1 [Theobroma cacao] 67 3e-09 ref|XP_002527867.1| 3-beta-hydroxy-delta5-steroid dehydrogenase,... 66 4e-09 ref|XP_003520935.1| PREDICTED: reticulon-like protein B12-like [... 64 3e-08 ref|XP_003516933.1| PREDICTED: reticulon-like protein B12-like [... 64 3e-08 ref|XP_004137740.1| PREDICTED: reticulon-like protein B12-like [... 63 4e-08 ref|XP_002323551.1| reticulon family protein [Populus trichocarp... 63 4e-08 ref|XP_006387780.1| hypothetical protein POPTR_0588s00200g, part... 63 5e-08 ref|XP_003604578.1| Reticulon-like protein B12 [Medicago truncat... 62 6e-08 ref|XP_004514940.1| PREDICTED: reticulon-like protein B12-like [... 62 8e-08 gb|ESW05964.1| hypothetical protein PHAVU_010G007900g [Phaseolus... 60 4e-07 ref|XP_006848072.1| hypothetical protein AMTR_s00029p00201410 [A... 60 4e-07 ref|XP_004246346.1| PREDICTED: reticulon-like protein B12-like [... 57 3e-06 ref|XP_006363068.1| PREDICTED: reticulon-like protein B12-like [... 56 6e-06 >ref|XP_002273700.1| PREDICTED: reticulon-like protein B12 [Vitis vinifera] gi|297740256|emb|CBI30438.3| unnamed protein product [Vitis vinifera] Length = 209 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYERYEDYID Y ++ YRKLQ +Y++ DEECI+ V KWILE +KLS Sbjct: 162 PALYERYEDYIDRYVMMGYRKLQLLYMKLDEECISKVQKWILEKRKLS 209 >emb|CAN64200.1| hypothetical protein VITISV_014341 [Vitis vinifera] Length = 445 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 P LYERYEDYID Y ++ YRKLQ +Y++ DEECI+ V KWILE +KLS Sbjct: 398 PXLYERYEDYIDRYVMMGYRKLQLLYMKLDEECISKVQKWILEKRKLS 445 >ref|XP_006480947.1| PREDICTED: reticulon-like protein B12-like [Citrus sinensis] Length = 210 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYERYED+ID YA++ YRKL+++YV+ DEE ++ V KWILE +KLS Sbjct: 163 PALYERYEDHIDKYAILGYRKLRQLYVKIDEEFVSKVRKWILEKQKLS 210 >ref|XP_006429275.1| hypothetical protein CICLE_v10012753mg [Citrus clementina] gi|557531332|gb|ESR42515.1| hypothetical protein CICLE_v10012753mg [Citrus clementina] Length = 210 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYERYED+ID YA++ YRKL+++YV+ DEE ++ V KWILE +KLS Sbjct: 163 PALYERYEDHIDKYAILGYRKLRQLYVKIDEEFVSKVRKWILEKQKLS 210 >gb|EXB89964.1| Reticulon-like protein [Morus notabilis] Length = 209 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/48 (60%), Positives = 40/48 (83%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYER+ED+ID Y ++ YRKLQ++YV DE+C++ V KW+LE +KLS Sbjct: 162 PALYERFEDHIDKYIILEYRKLQQLYVFVDEKCVSKVQKWVLEKRKLS 209 >gb|EOY07311.1| Reticulon family protein isoform 3 [Theobroma cacao] Length = 183 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/48 (56%), Positives = 40/48 (83%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYERYE+YI++YA+ +RK+Q++YV+FD + + + KWILE +KLS Sbjct: 136 PALYERYENYINSYAITGFRKMQQLYVKFDAKFVNRIRKWILERQKLS 183 >gb|EOY07310.1| Reticulon family protein isoform 2 [Theobroma cacao] Length = 209 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/48 (56%), Positives = 40/48 (83%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYERYE+YI++YA+ +RK+Q++YV+FD + + + KWILE +KLS Sbjct: 162 PALYERYENYINSYAITGFRKMQQLYVKFDAKFVNRIRKWILERQKLS 209 >gb|EOY07309.1| Reticulon family protein isoform 1 [Theobroma cacao] Length = 228 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/48 (56%), Positives = 40/48 (83%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYERYE+YI++YA+ +RK+Q++YV+FD + + + KWILE +KLS Sbjct: 181 PALYERYENYINSYAITGFRKMQQLYVKFDAKFVNRIRKWILERQKLS 228 >ref|XP_002527867.1| 3-beta-hydroxy-delta5-steroid dehydrogenase, putative [Ricinus communis] gi|223532718|gb|EEF34498.1| 3-beta-hydroxy-delta5-steroid dehydrogenase, putative [Ricinus communis] Length = 209 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYER+ED+ID Y + Y K Q++YV FD ECI + KWILE +KLS Sbjct: 162 PALYERHEDFIDKYVKMGYEKSQQLYVNFDVECIGRIRKWILEKQKLS 209 >ref|XP_003520935.1| PREDICTED: reticulon-like protein B12-like [Glycine max] Length = 209 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PA+YERYEDYID Y L YRKL ++++ +E+ + VH WILE KKLS Sbjct: 162 PAIYERYEDYIDKYILKGYRKLCLLHLKINEQYVNKVHNWILEKKKLS 209 >ref|XP_003516933.1| PREDICTED: reticulon-like protein B12-like [Glycine max] Length = 209 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PA+YERYEDYID Y L YRKL ++V+ +E ++ VH WILE KKLS Sbjct: 162 PAIYERYEDYIDMYILKGYRKLCLLHVKINEGYVSKVHNWILEKKKLS 209 >ref|XP_004137740.1| PREDICTED: reticulon-like protein B12-like [Cucumis sativus] gi|449483434|ref|XP_004156590.1| PREDICTED: reticulon-like protein B12-like [Cucumis sativus] Length = 209 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYE+YEDY+D +A++ Y+KL + YV+ DE + T +WILE +KLS Sbjct: 162 PALYEKYEDYVDRHAILMYKKLYQFYVKLDEMRVLTYQQWILEKEKLS 209 >ref|XP_002323551.1| reticulon family protein [Populus trichocarpa] gi|222868181|gb|EEF05312.1| reticulon family protein [Populus trichocarpa] Length = 209 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYERYEDYID YA + ++K ++Y++ D ECI V WILE +KLS Sbjct: 162 PALYERYEDYIDRYAEMVFKKSHQLYLKVDVECIGRVQNWILERQKLS 209 >ref|XP_006387780.1| hypothetical protein POPTR_0588s00200g, partial [Populus trichocarpa] gi|550308433|gb|ERP46694.1| hypothetical protein POPTR_0588s00200g, partial [Populus trichocarpa] Length = 125 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYERYEDY+D YA + ++K ++Y++ D ECI V WILE +KLS Sbjct: 78 PALYERYEDYLDRYAELVFKKSHQLYLKVDVECIGRVQNWILERQKLS 125 >ref|XP_003604578.1| Reticulon-like protein B12 [Medicago truncatula] gi|355505633|gb|AES86775.1| Reticulon-like protein B12 [Medicago truncatula] Length = 209 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYERYEDYIDT+ L Y KL ++Y + +E+ I+ V WILE KKLS Sbjct: 162 PALYERYEDYIDTFVLKCYNKLCQLYRKINEKYISRVQNWILEKKKLS 209 >ref|XP_004514940.1| PREDICTED: reticulon-like protein B12-like [Cicer arietinum] Length = 209 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYERYEDYIDT+ L Y KL ++Y + +EE ++ + WILE KKLS Sbjct: 162 PALYERYEDYIDTFILKCYNKLCQLYRKINEEYVSKIQYWILEKKKLS 209 >gb|ESW05964.1| hypothetical protein PHAVU_010G007900g [Phaseolus vulgaris] Length = 209 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PA+YERYE+YID Y L Y+ L ++V+ +E+ ++ VH WILE KKLS Sbjct: 162 PAIYERYEEYIDMYILKGYKNLCFLHVKINEKYVSRVHNWILEKKKLS 209 >ref|XP_006848072.1| hypothetical protein AMTR_s00029p00201410 [Amborella trichopoda] gi|548851377|gb|ERN09653.1| hypothetical protein AMTR_s00029p00201410 [Amborella trichopoda] Length = 209 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKK 179 PALYE+YED+IDTYA Y +L ++YV+ DEEC + + KWI +K Sbjct: 162 PALYEKYEDHIDTYAEKAYTELLKLYVKLDEECFSKIRKWIQAKRK 207 >ref|XP_004246346.1| PREDICTED: reticulon-like protein B12-like [Solanum lycopersicum] Length = 209 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYE+YED +D Y L+ YRKL +Y +FD C+ V + LE KKLS Sbjct: 162 PALYEKYEDQVDAYVLMAYRKLWLLYRKFDAVCVNKVSRLSLEKKKLS 209 >ref|XP_006363068.1| PREDICTED: reticulon-like protein B12-like [Solanum tuberosum] Length = 209 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = -3 Query: 316 PALYERYEDYIDTYALIWYRKLQRIYVRFDEECITTVHKWILETKKLS 173 PALYE+YED +D Y L+ YRKL ++Y +FD C+ V LE KKLS Sbjct: 162 PALYEKYEDQVDAYVLMAYRKLWQLYHKFDAVCVNKVPILSLEKKKLS 209