BLASTX nr result
ID: Rehmannia22_contig00035417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00035417 (476 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362997.1| PREDICTED: pentatricopeptide repeat-containi... 168 8e-40 ref|XP_004243565.1| PREDICTED: pentatricopeptide repeat-containi... 161 7e-38 gb|EPS73698.1| hypothetical protein M569_01057 [Genlisea aurea] 160 2e-37 gb|EOX93483.1| Tetratricopeptide repeat (TPR)-like superfamily p... 145 7e-33 ref|XP_006469492.1| PREDICTED: pentatricopeptide repeat-containi... 144 1e-32 ref|XP_002269867.1| PREDICTED: pentatricopeptide repeat-containi... 144 2e-32 ref|XP_004140069.1| PREDICTED: pentatricopeptide repeat-containi... 143 2e-32 ref|XP_006447772.1| hypothetical protein CICLE_v10018243mg [Citr... 143 3e-32 gb|EMJ17863.1| hypothetical protein PRUPE_ppb017187mg [Prunus pe... 143 3e-32 ref|XP_004303560.1| PREDICTED: pentatricopeptide repeat-containi... 142 5e-32 ref|XP_004510327.1| PREDICTED: pentatricopeptide repeat-containi... 133 3e-29 ref|XP_006285690.1| hypothetical protein CARUB_v10007160mg [Caps... 132 5e-29 ref|XP_002530223.1| pentatricopeptide repeat-containing protein,... 132 5e-29 ref|XP_002869597.1| pentatricopeptide repeat-containing protein ... 131 8e-29 ref|XP_006843235.1| hypothetical protein AMTR_s00080p00074320 [A... 130 2e-28 ref|NP_194398.1| pentatricopeptide repeat-containing protein [Ar... 129 4e-28 ref|XP_006413152.1| hypothetical protein EUTSA_v10024897mg [Eutr... 128 7e-28 ref|XP_003625044.1| Pentatricopeptide repeat-containing protein ... 125 6e-27 ref|XP_002320514.2| hypothetical protein POPTR_0014s16390g [Popu... 124 1e-26 ref|XP_003531640.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 >ref|XP_006362997.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Solanum tuberosum] Length = 530 Score = 168 bits (425), Expect = 8e-40 Identities = 85/141 (60%), Positives = 106/141 (75%) Frame = -2 Query: 424 MKNLLQWSRFSTFLKPIKAHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVH 245 MK L Q +FSTF+ K + ++ P K +PI LPHRT+ GQDLDFVN+ H Sbjct: 1 MKILKQIRKFSTFIDSTKHTHQVFVKLITPKRSKLDPIPLPHRTISDPKGQDLDFVNVAH 60 Query: 244 SHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISII 65 SHLIHS+W KL L+SGLTPFR+KHILLK +KDYVLSLEFFKWVE+K+ NTL+ SI+ Sbjct: 61 SHLIHSDWTKLENLSSGLTPFRVKHILLKIQKDYVLSLEFFKWVEVKSPNSNTLENHSIV 120 Query: 64 LHILTKNRKFISAESILRRVL 2 LH+LTK++KF SAESILR++L Sbjct: 121 LHVLTKSKKFKSAESILRKLL 141 >ref|XP_004243565.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Solanum lycopersicum] Length = 530 Score = 161 bits (408), Expect = 7e-38 Identities = 83/141 (58%), Positives = 104/141 (73%) Frame = -2 Query: 424 MKNLLQWSRFSTFLKPIKAHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVH 245 MK L Q +FSTFL K + ++ K +PI LPHRT+ GQDLDFVN+ H Sbjct: 1 MKILKQIRKFSTFLDSTKNTHQVFVKSIATKQSKLDPIPLPHRTISEPKGQDLDFVNVAH 60 Query: 244 SHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISII 65 SHL+HS+W KL L+SGLT FR+KHILLK +KDYVLSLEFFKWVE+K+ NTL+ SI+ Sbjct: 61 SHLVHSDWTKLENLSSGLTQFRVKHILLKIQKDYVLSLEFFKWVEVKSPNSNTLENHSIV 120 Query: 64 LHILTKNRKFISAESILRRVL 2 LH+LTK++KF SAESILR++L Sbjct: 121 LHVLTKSKKFKSAESILRKLL 141 >gb|EPS73698.1| hypothetical protein M569_01057 [Genlisea aurea] Length = 500 Score = 160 bits (405), Expect = 2e-37 Identities = 81/135 (60%), Positives = 105/135 (77%), Gaps = 1/135 (0%) Frame = -2 Query: 403 SRFSTFLKPIKAHLKNPIEFSLPTNY-KKNPILLPHRTMLPAIGQDLDFVNIVHSHLIHS 227 S F + + ++N +E SLP + +KN ILLPHRT+ A GQDLD VN+++SHLIHS Sbjct: 5 SHLRKFSQTKSSPVRNAVESSLPADRNRKNAILLPHRTLPTAKGQDLDAVNVIYSHLIHS 64 Query: 226 EWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISIILHILTK 47 +WDKL++ S LTPFRIKH+LLK++KD+ L+ EFFKWVELKNS+L TLDV I LHILTK Sbjct: 65 DWDKLDESVSCLTPFRIKHVLLKSQKDHHLAFEFFKWVELKNSQLITLDVNCIALHILTK 124 Query: 46 NRKFISAESILRRVL 2 RKFISA+SI+++ L Sbjct: 125 YRKFISAQSIIKKTL 139 >gb|EOX93483.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 532 Score = 145 bits (365), Expect = 7e-33 Identities = 73/141 (51%), Positives = 97/141 (68%) Frame = -2 Query: 424 MKNLLQWSRFSTFLKPIKAHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVH 245 M N +FST L +K P + PI +P RT+ GQDLDFVN+ H Sbjct: 1 MNNHFPGRQFSTLLDSVKL---KPFNDGISRRRNWYPIPIPFRTIPEPRGQDLDFVNVAH 57 Query: 244 SHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISII 65 SHLIHS+WDKLN L++ LTPFR+KHILL+ +KD+VLSLEFF WV+ +N ++L+ S+I Sbjct: 58 SHLIHSDWDKLNALSTHLTPFRVKHILLRIQKDHVLSLEFFNWVQTQNPTSHSLETRSMI 117 Query: 64 LHILTKNRKFISAESILRRVL 2 LHILT+N+KF SAES+LR ++ Sbjct: 118 LHILTRNQKFKSAESVLRTII 138 >ref|XP_006469492.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like isoform X1 [Citrus sinensis] gi|568830409|ref|XP_006469493.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like isoform X2 [Citrus sinensis] gi|568830411|ref|XP_006469494.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like isoform X3 [Citrus sinensis] Length = 565 Score = 144 bits (363), Expect = 1e-32 Identities = 79/144 (54%), Positives = 98/144 (68%), Gaps = 5/144 (3%) Frame = -2 Query: 418 NLLQWSRFSTFLKPIKAHLKNP--IEFSLPTNYKK---NPILLPHRTMLPAIGQDLDFVN 254 N+ + R ST + + KNP I S+ N K NPI +PHRT+ GQD DFVN Sbjct: 27 NVFPFRRLSTMVTTLD---KNPTFINPSVSENSMKMNRNPIPIPHRTLPEPKGQDFDFVN 83 Query: 253 IVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVI 74 I +SHLIHS+W KL L++ LTPFR+KH+LLK +KDYVLSLEFF WV+ TL+ Sbjct: 84 ITYSHLIHSDWKKLTALSTHLTPFRVKHVLLKVQKDYVLSLEFFTWVQTHKPSSLTLETH 143 Query: 73 SIILHILTKNRKFISAESILRRVL 2 SI+LHILTKNRKF S+ESILR +L Sbjct: 144 SIVLHILTKNRKFKSSESILRGIL 167 >ref|XP_002269867.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Vitis vinifera] Length = 616 Score = 144 bits (362), Expect = 2e-32 Identities = 68/112 (60%), Positives = 88/112 (78%), Gaps = 2/112 (1%) Frame = -2 Query: 331 NYKK--NPILLPHRTMLPAIGQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLK 158 NY + NPI +PHRT+ GQDLDFVN+ HSHLI+S+W KLN +++GLTP+R+KHI+LK Sbjct: 107 NYMRSWNPIPVPHRTIPEPRGQDLDFVNVAHSHLINSDWAKLNSMSTGLTPYRMKHIMLK 166 Query: 157 TRKDYVLSLEFFKWVELKNSELNTLDVISIILHILTKNRKFISAESILRRVL 2 +KD+VLS EFF WV+ +N TL+ SIILHILTKN KF SAES+L+ +L Sbjct: 167 IKKDHVLSFEFFNWVKAQNPNCQTLETYSIILHILTKNHKFKSAESVLKGIL 218 >ref|XP_004140069.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Cucumis sativus] gi|449528063|ref|XP_004171026.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Cucumis sativus] Length = 536 Score = 143 bits (361), Expect = 2e-32 Identities = 77/140 (55%), Positives = 97/140 (69%), Gaps = 3/140 (2%) Frame = -2 Query: 412 LQWSRFSTFLKPIK---AHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVHS 242 L + RFST L + A + + SL ++ I +PHR++ G DLDFVN+VHS Sbjct: 4 LPFRRFSTLLGSVPRTYASISPKFDLSLGKR-NRDSIPIPHRSIPEPRGPDLDFVNVVHS 62 Query: 241 HLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISIIL 62 HLIHS+W KL+ L+ GLT FR+KHILLKT+KDYVLSLEFF WV +N +TL+ IIL Sbjct: 63 HLIHSDWSKLDCLSMGLTAFRVKHILLKTQKDYVLSLEFFNWVATQNPSSHTLETHCIIL 122 Query: 61 HILTKNRKFISAESILRRVL 2 HILTK RKF SAESILR ++ Sbjct: 123 HILTKRRKFKSAESILRSII 142 >ref|XP_006447772.1| hypothetical protein CICLE_v10018243mg [Citrus clementina] gi|557550383|gb|ESR61012.1| hypothetical protein CICLE_v10018243mg [Citrus clementina] Length = 565 Score = 143 bits (360), Expect = 3e-32 Identities = 79/144 (54%), Positives = 97/144 (67%), Gaps = 5/144 (3%) Frame = -2 Query: 418 NLLQWSRFSTFLKPIKAHLKNP--IEFSLPTNYKK---NPILLPHRTMLPAIGQDLDFVN 254 N+ R ST + + KNP I S+ N K NPI +PHRT+ GQD DFVN Sbjct: 27 NVFPLRRLSTMVTTLD---KNPTFINPSVSENSMKMNRNPIPIPHRTLPDPKGQDFDFVN 83 Query: 253 IVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVI 74 I +SHLIHS+W KL L++ LTPFR+KH+LLK +KDYVLSLEFF WV+ TL+ Sbjct: 84 IAYSHLIHSDWKKLTALSTHLTPFRVKHVLLKVQKDYVLSLEFFTWVQTHKPSSLTLETH 143 Query: 73 SIILHILTKNRKFISAESILRRVL 2 SI+LHILTKNRKF S+ESILR +L Sbjct: 144 SIVLHILTKNRKFKSSESILRGIL 167 >gb|EMJ17863.1| hypothetical protein PRUPE_ppb017187mg [Prunus persica] Length = 533 Score = 143 bits (360), Expect = 3e-32 Identities = 70/106 (66%), Positives = 85/106 (80%) Frame = -2 Query: 319 NPILLPHRTMLPAIGQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYV 140 NP+ +PHRT+ GQDLDFVN+ +SHLIHS+W KLN L++GLT FR+KHILLK ++DYV Sbjct: 37 NPLPIPHRTIPEPKGQDLDFVNVANSHLIHSDWAKLNSLSNGLTAFRVKHILLKLKQDYV 96 Query: 139 LSLEFFKWVELKNSELNTLDVISIILHILTKNRKFISAESILRRVL 2 LSLEFF WV +N TL+ S+ILHILTK RKF SAESILR+VL Sbjct: 97 LSLEFFNWVAAQNPTSLTLETHSMILHILTKYRKFKSAESILRKVL 142 >ref|XP_004303560.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 539 Score = 142 bits (358), Expect = 5e-32 Identities = 73/121 (60%), Positives = 89/121 (73%), Gaps = 6/121 (4%) Frame = -2 Query: 346 FSLPTNYKK------NPILLPHRTMLPAIGQDLDFVNIVHSHLIHSEWDKLNKLASGLTP 185 F+ P+ Y K NPI +PHRT+ GQDLDFVN+V+SHLIHS+W KLN LA+GLT Sbjct: 22 FTKPSVYVKLETRNWNPIPIPHRTIPEPKGQDLDFVNVVNSHLIHSDWAKLNSLANGLTA 81 Query: 184 FRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISIILHILTKNRKFISAESILRRV 5 FR+KH+ LK +KDYV+SLEFF WV TL+ S+ILHILTK RKF SAESILR++ Sbjct: 82 FRVKHVFLKVQKDYVVSLEFFNWVGTHKPTSLTLETHSMILHILTKYRKFKSAESILRKI 141 Query: 4 L 2 L Sbjct: 142 L 142 >ref|XP_004510327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Cicer arietinum] Length = 515 Score = 133 bits (334), Expect = 3e-29 Identities = 66/141 (46%), Positives = 95/141 (67%) Frame = -2 Query: 424 MKNLLQWSRFSTFLKPIKAHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVH 245 MK ++++ +FST S+ T KK+ + +PH+T+ GQDLDF+N+ H Sbjct: 1 MKRIIRFHQFSTI--------------SIQTFPKKHYLPIPHQTIPQPKGQDLDFINVFH 46 Query: 244 SHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISII 65 S++IHS+W+KLN L++ LTPFRIKHILLK + D+VLSL+FF WV N +TL S I Sbjct: 47 SNIIHSQWEKLNPLSNSLTPFRIKHILLKLQNDHVLSLKFFNWVNTHNPNSHTLQTHSFI 106 Query: 64 LHILTKNRKFISAESILRRVL 2 LHILTKNR F +++SI +++ Sbjct: 107 LHILTKNRNFRTSQSIFSKII 127 >ref|XP_006285690.1| hypothetical protein CARUB_v10007160mg [Capsella rubella] gi|482554395|gb|EOA18588.1| hypothetical protein CARUB_v10007160mg [Capsella rubella] Length = 513 Score = 132 bits (332), Expect = 5e-29 Identities = 71/135 (52%), Positives = 93/135 (68%), Gaps = 1/135 (0%) Frame = -2 Query: 403 SRFSTFLKPIKAHL-KNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVHSHLIHS 227 +RFS+F K L KN S+P +++NP GQDLDFVN+ HSHLI S Sbjct: 9 NRFSSFAGSEKPRLSKNLGAASIPIPHRRNP---------EPKGQDLDFVNVAHSHLIQS 59 Query: 226 EWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISIILHILTK 47 +WDKLNKL+ L FR+K+IL+K +KDY+LSLEFF W + +N + ++L+ +I+LH LTK Sbjct: 60 DWDKLNKLSDHLDSFRVKNILVKIQKDYLLSLEFFNWAKTRNPDSHSLETHAIVLHTLTK 119 Query: 46 NRKFISAESILRRVL 2 NRKF SAESILR VL Sbjct: 120 NRKFKSAESILRDVL 134 >ref|XP_002530223.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530270|gb|EEF32170.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 517 Score = 132 bits (332), Expect = 5e-29 Identities = 63/92 (68%), Positives = 76/92 (82%) Frame = -2 Query: 277 GQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNS 98 GQDLDFVN+ HSHLIHS+W KL L++ LTPFR+KHILLK +KD+VLSLEFF WV+ +N Sbjct: 29 GQDLDFVNVAHSHLIHSDWKKLTSLSTHLTPFRVKHILLKIQKDHVLSLEFFNWVQTENP 88 Query: 97 ELNTLDVISIILHILTKNRKFISAESILRRVL 2 +TL+ S+ILHILTKNRKF SAE IL+ VL Sbjct: 89 SSHTLETHSMILHILTKNRKFKSAELILKSVL 120 >ref|XP_002869597.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315433|gb|EFH45856.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 538 Score = 131 bits (330), Expect = 8e-29 Identities = 70/143 (48%), Positives = 94/143 (65%), Gaps = 1/143 (0%) Frame = -2 Query: 427 NMKNLLQWSRFSTFLKPIKAHL-KNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNI 251 N + Q+S F+ + + L KNP ++P +PHR+ GQDLDFVN+ Sbjct: 9 NRRLCYQYSSFAGYGRSENPRLSKNPPAANIP---------IPHRSNPEPKGQDLDFVNV 59 Query: 250 VHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVIS 71 HSHLI S+WDKLNKL+ L FR+K++LLK +KDY+LS EFF W + +N ++L+ + Sbjct: 60 AHSHLIQSDWDKLNKLSDHLDSFRVKNVLLKIQKDYLLSFEFFNWAKTRNPASHSLETHA 119 Query: 70 IILHILTKNRKFISAESILRRVL 2 I+LH LTKNRKF SAESILR VL Sbjct: 120 IVLHTLTKNRKFKSAESILRDVL 142 >ref|XP_006843235.1| hypothetical protein AMTR_s00080p00074320 [Amborella trichopoda] gi|548845519|gb|ERN04910.1| hypothetical protein AMTR_s00080p00074320 [Amborella trichopoda] Length = 489 Score = 130 bits (327), Expect = 2e-28 Identities = 61/90 (67%), Positives = 73/90 (81%) Frame = -2 Query: 277 GQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNS 98 GQDLDF+N VHSHLIH EW KLN LA GLTPFR+ HIL+KT+KD+VLSLEFF W + N Sbjct: 6 GQDLDFINFVHSHLIHLEWPKLNSLAHGLTPFRVNHILVKTQKDHVLSLEFFTWAQQTNP 65 Query: 97 ELNTLDVISIILHILTKNRKFISAESILRR 8 TL+ SIILHILTK+RKF SAE++L++ Sbjct: 66 NSQTLETHSIILHILTKSRKFRSAEALLKK 95 >ref|NP_194398.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334186944|ref|NP_001190849.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75213515|sp|Q9SZ10.1|PP338_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g26680, mitochondrial; Flags: Precursor gi|4455191|emb|CAB36514.1| putative protein [Arabidopsis thaliana] gi|7269520|emb|CAB79523.1| putative protein [Arabidopsis thaliana] gi|332659836|gb|AEE85236.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332659837|gb|AEE85237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 521 Score = 129 bits (324), Expect = 4e-28 Identities = 62/102 (60%), Positives = 78/102 (76%) Frame = -2 Query: 307 LPHRTMLPAIGQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLE 128 +PHR GQDLDFVN+ HSHLI S+WDKLNKL+ L FR+K++LLK +KDY+LSLE Sbjct: 41 IPHRRNPEPKGQDLDFVNVAHSHLIQSDWDKLNKLSDHLDSFRVKNVLLKIQKDYLLSLE 100 Query: 127 FFKWVELKNSELNTLDVISIILHILTKNRKFISAESILRRVL 2 FF W + +N ++L+ +I+LH LTKNRKF SAESILR VL Sbjct: 101 FFNWAKTRNPGSHSLETHAIVLHTLTKNRKFKSAESILRDVL 142 >ref|XP_006413152.1| hypothetical protein EUTSA_v10024897mg [Eutrema salsugineum] gi|557114322|gb|ESQ54605.1| hypothetical protein EUTSA_v10024897mg [Eutrema salsugineum] Length = 528 Score = 128 bits (322), Expect = 7e-28 Identities = 61/107 (57%), Positives = 82/107 (76%) Frame = -2 Query: 322 KNPILLPHRTMLPAIGQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDY 143 +N I +PHR+ GQDLDFVN+ HSHLI S+WD+L+KL+ L FR+K+ILL+ +KDY Sbjct: 43 RNAIPIPHRSNPEPKGQDLDFVNVAHSHLIQSDWDQLDKLSKHLDSFRVKNILLRIQKDY 102 Query: 142 VLSLEFFKWVELKNSELNTLDVISIILHILTKNRKFISAESILRRVL 2 +LSLEFF W + +N ++L+ +I+LH LTKNRKF SAESILR +L Sbjct: 103 LLSLEFFNWAKTRNPGSHSLETHAIVLHTLTKNRKFKSAESILRDIL 149 >ref|XP_003625044.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500059|gb|AES81262.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 521 Score = 125 bits (314), Expect = 6e-27 Identities = 66/141 (46%), Positives = 91/141 (64%) Frame = -2 Query: 424 MKNLLQWSRFSTFLKPIKAHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVH 245 MK +++ +FST I++H K + LP +PHRT+ GQDLDF+NI H Sbjct: 1 MKKTIRFHQFST--TSIQSHTKTHSPY-LP---------IPHRTLPQPKGQDLDFINIFH 48 Query: 244 SHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISII 65 SH IHS+W+KL + LTPF+I+HILLK + D VLSL+FF WV+ N +TL S + Sbjct: 49 SHFIHSQWEKLTPFSKTLTPFKIQHILLKLQNDAVLSLKFFNWVQTHNPNSHTLHTHSFL 108 Query: 64 LHILTKNRKFISAESILRRVL 2 LHILTKNR F +A+SI +++ Sbjct: 109 LHILTKNRNFKTAQSIFSKII 129 >ref|XP_002320514.2| hypothetical protein POPTR_0014s16390g [Populus trichocarpa] gi|550324329|gb|EEE98829.2| hypothetical protein POPTR_0014s16390g [Populus trichocarpa] Length = 506 Score = 124 bits (311), Expect = 1e-26 Identities = 62/92 (67%), Positives = 74/92 (80%) Frame = -2 Query: 277 GQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNS 98 GQDLDFVN+VHSHLIHS+WDKLNKL++ TPFR+ HILLK +KD+VLSLEFF ++ N Sbjct: 20 GQDLDFVNVVHSHLIHSDWDKLNKLSTHFTPFRVNHILLKIQKDHVLSLEFFNSLKTLNP 79 Query: 97 ELNTLDVISIILHILTKNRKFISAESILRRVL 2 TL+ SIILHILTK KF SA+SILR +L Sbjct: 80 ISLTLETHSIILHILTKKSKFKSAQSILRTLL 111 >ref|XP_003531640.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like isoform 2 [Glycine max] Length = 522 Score = 103 bits (258), Expect = 2e-20 Identities = 60/143 (41%), Positives = 86/143 (60%), Gaps = 2/143 (1%) Frame = -2 Query: 424 MKNLLQWSRFSTFLKPIKAHLKNPIE--FSLPTNYKKNPILLPHRTMLPAIGQDLDFVNI 251 M+N+ Q RFST ++P K P F LP +PHRT+ GQDLDF+ + Sbjct: 1 MRNI-QPHRFSTLIEPPN---KTPTSKPFFLP---------IPHRTIPEPRGQDLDFICV 47 Query: 250 VHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVIS 71 H H+I+S W+KL L++ LTPFR+KH+LL + D+V SL+ WV N +TLD S Sbjct: 48 AHRHVINSHWEKLLPLSTSLTPFRLKHLLLALQNDHVSSLKLSTWVLKHNPSSHTLDTHS 107 Query: 70 IILHILTKNRKFISAESILRRVL 2 I+LH L+K+R+F + + L + L Sbjct: 108 ILLHTLSKHRQFKTTQKFLTQTL 130