BLASTX nr result
ID: Rehmannia22_contig00035197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00035197 (581 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001616705.1| hypothetical protein [Plasmodium vivax Sal-1... 56 6e-06 >ref|XP_001616705.1| hypothetical protein [Plasmodium vivax Sal-1] gi|148805579|gb|EDL46978.1| hypothetical protein, conserved [Plasmodium vivax] Length = 2053 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/67 (38%), Positives = 41/67 (61%) Frame = +2 Query: 197 KSRLESRQEHQPENRHDDGQDNCRHKCRQDCGQLSGHKNDNNVGRQDCGQYCRHDCGQDC 376 K + +SR E + E +++ ++ CR++C+Q+C N R DC Q CRHDC Q+C Sbjct: 717 KKKTDSRNECKNECKNEC-KNECRNECKQEC---------KNECRHDCKQECRHDCKQEC 766 Query: 377 RHEGGHN 397 RHEG ++ Sbjct: 767 RHEGAND 773