BLASTX nr result
ID: Rehmannia22_contig00034888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00034888 (729 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ13433.1| hypothetical protein PRUPE_ppa013389mg [Prunus pe... 59 2e-06 >gb|EMJ13433.1| hypothetical protein PRUPE_ppa013389mg [Prunus persica] Length = 125 Score = 58.5 bits (140), Expect = 2e-06 Identities = 50/133 (37%), Positives = 63/133 (47%), Gaps = 9/133 (6%) Frame = -2 Query: 650 MKFLLEFVTCSG----SCSSEARRPAEETRLLVVQEPRRRVXXXXXXXXXXXXXG--EWR 489 MKFLLEFV+C G + + E +EET LV + RRR EWR Sbjct: 1 MKFLLEFVSCCGIARPATTGEQAPLSEETSSLVPRRMRRRRKRGRPGNSGSTSPNSVEWR 60 Query: 488 PSLSSISED---VLMAERIKNVERPAAGWRKSLQTKVXXXXXXXXXXXXXXXXXXRAPLP 318 PSL+SISED ++ +R VER A RKS Q++ +A L Sbjct: 61 PSLTSISEDNVVAMVVDRTAEVER--AMKRKSGQSRT------IAQVRSHGEDYGQASLT 112 Query: 317 DIMPTFSPTPFMF 279 +P FSPTPFMF Sbjct: 113 TAIPAFSPTPFMF 125