BLASTX nr result
ID: Rehmannia22_contig00034495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00034495 (681 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001931962.1| inclusion body/transactivation factor [Lamiu... 49 3e-10 >ref|YP_001931962.1| inclusion body/transactivation factor [Lamium leaf distortion virus] gi|172041758|gb|ACB69768.1| inclusion body/transactivation factor [Lamium leaf distortion virus] Length = 517 Score = 49.3 bits (116), Expect(2) = 3e-10 Identities = 28/69 (40%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Frame = -2 Query: 581 QKVNSKPCCSNTANHESSPELQVSGKDLTNLVILVALGKSKTEVQTSPKLVIPTKL-ITP 405 +KVNS+PC + ESSPE +GKD +N + + K+ EVQTS KLV P+ + P Sbjct: 75 EKVNSEPCTEKSLQSESSPEQTATGKDTSNPLKDSSFPKAMPEVQTSSKLVKPSDFSLRP 134 Query: 404 EDFVTGLRP 378 F+ P Sbjct: 135 NGFMGNPMP 143 Score = 42.0 bits (97), Expect(2) = 3e-10 Identities = 20/39 (51%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -3 Query: 274 LVFNGLHPGIYTSWAKASFAIKGF-NVVHKRFKSFAKVR 161 +VFNG PGIYT+W A A K NV+HK++K F + R Sbjct: 171 VVFNGPLPGIYTNWPAAQQATKNVSNVLHKKYKGFIEAR 209