BLASTX nr result
ID: Rehmannia22_contig00034472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00034472 (523 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518162.1| PREDICTED: putative pentatricopeptide repeat... 109 4e-22 ref|XP_002269283.1| PREDICTED: putative pentatricopeptide repeat... 108 1e-21 ref|XP_004497693.1| PREDICTED: putative pentatricopeptide repeat... 106 4e-21 ref|XP_004303386.1| PREDICTED: putative pentatricopeptide repeat... 106 4e-21 ref|XP_004303385.1| PREDICTED: putative pentatricopeptide repeat... 106 4e-21 gb|ESW17764.1| hypothetical protein PHAVU_007G266200g [Phaseolus... 104 1e-20 gb|EMJ05692.1| hypothetical protein PRUPE_ppa019635mg [Prunus pe... 104 1e-20 ref|XP_002524089.1| pentatricopeptide repeat-containing protein,... 103 2e-20 gb|EPS63838.1| hypothetical protein M569_10945, partial [Genlise... 103 3e-20 ref|XP_006286714.1| hypothetical protein CARUB_v10002874mg [Caps... 103 3e-20 ref|XP_002871218.1| pentatricopeptide repeat-containing protein ... 103 3e-20 gb|EXC12963.1| hypothetical protein L484_016893 [Morus notabilis] 102 5e-20 ref|XP_002308333.2| pentatricopeptide repeat-containing family p... 102 7e-20 ref|XP_002333469.1| predicted protein [Populus trichocarpa] 102 7e-20 ref|XP_006481630.1| PREDICTED: putative pentatricopeptide repeat... 101 1e-19 ref|XP_006430030.1| hypothetical protein CICLE_v10010964mg [Citr... 101 1e-19 ref|XP_006399113.1| hypothetical protein EUTSA_v10012543mg [Eutr... 100 3e-19 ref|XP_006826424.1| hypothetical protein AMTR_s00004p00162290 [A... 100 3e-19 ref|XP_006348568.1| PREDICTED: putative pentatricopeptide repeat... 99 6e-19 ref|XP_004228915.1| PREDICTED: putative pentatricopeptide repeat... 99 6e-19 >ref|XP_003518162.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial-like [Glycine max] Length = 1034 Score = 109 bits (272), Expect = 4e-22 Identities = 50/64 (78%), Positives = 57/64 (89%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGP PDFKTYSMF+ CLCKVGKSEE +LISEML GI+PSTINFRT++YGLNREGK +L Sbjct: 956 KGPFPDFKTYSMFLTCLCKVGKSEEGMRLISEMLDSGIVPSTINFRTVVYGLNREGKHDL 1015 Query: 184 AQVV 195 A+VV Sbjct: 1016 ARVV 1019 >ref|XP_002269283.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial-like [Vitis vinifera] Length = 1048 Score = 108 bits (269), Expect = 1e-21 Identities = 50/64 (78%), Positives = 57/64 (89%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGP PDFKTYSMFI CLCKVGKSEEA +L+SEML GIIPSTINFRT+++GLNREGK +L Sbjct: 972 KGPFPDFKTYSMFISCLCKVGKSEEALQLLSEMLDSGIIPSTINFRTVMFGLNREGKHSL 1031 Query: 184 AQVV 195 A +V Sbjct: 1032 ANIV 1035 >ref|XP_004497693.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial-like [Cicer arietinum] Length = 1045 Score = 106 bits (264), Expect = 4e-21 Identities = 50/64 (78%), Positives = 55/64 (85%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGP PDFKTYSMF+ CLCK G+SEEA +LISEML GI+PSTINFRT+ YGLNREGK L Sbjct: 967 KGPFPDFKTYSMFLCCLCKDGRSEEAMRLISEMLESGIVPSTINFRTVFYGLNREGKYGL 1026 Query: 184 AQVV 195 AQVV Sbjct: 1027 AQVV 1030 >ref|XP_004303386.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial-like isoform 2 [Fragaria vesca subsp. vesca] Length = 1037 Score = 106 bits (264), Expect = 4e-21 Identities = 48/64 (75%), Positives = 56/64 (87%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGPSPDFKTYSMF+ CLCK GKSEEA +LI+EML+ GIIPS +NFRT+ YGLNREGK +L Sbjct: 960 KGPSPDFKTYSMFLHCLCKAGKSEEAMQLITEMLNSGIIPSVVNFRTVFYGLNREGKHDL 1019 Query: 184 AQVV 195 A+ V Sbjct: 1020 ARTV 1023 >ref|XP_004303385.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial-like isoform 1 [Fragaria vesca subsp. vesca] Length = 1038 Score = 106 bits (264), Expect = 4e-21 Identities = 48/64 (75%), Positives = 56/64 (87%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGPSPDFKTYSMF+ CLCK GKSEEA +LI+EML+ GIIPS +NFRT+ YGLNREGK +L Sbjct: 960 KGPSPDFKTYSMFLHCLCKAGKSEEAMQLITEMLNSGIIPSVVNFRTVFYGLNREGKHDL 1019 Query: 184 AQVV 195 A+ V Sbjct: 1020 ARTV 1023 >gb|ESW17764.1| hypothetical protein PHAVU_007G266200g [Phaseolus vulgaris] Length = 1069 Score = 104 bits (260), Expect = 1e-20 Identities = 49/64 (76%), Positives = 55/64 (85%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGP PDFKTYSMF+ CLCKVG+SEEA +LI EML GI+PSTINFRT+ YGLNREGK L Sbjct: 991 KGPFPDFKTYSMFLTCLCKVGRSEEAMQLIFEMLDSGIVPSTINFRTVFYGLNREGKNAL 1050 Query: 184 AQVV 195 A+VV Sbjct: 1051 ARVV 1054 >gb|EMJ05692.1| hypothetical protein PRUPE_ppa019635mg [Prunus persica] Length = 893 Score = 104 bits (259), Expect = 1e-20 Identities = 48/65 (73%), Positives = 55/65 (84%) Frame = +1 Query: 1 QKGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPN 180 QKGP PDF+TYSMFI CLCKVGKSEEA LI EML+ GI+PS +NFRT+ YGLNREGK + Sbjct: 815 QKGPLPDFRTYSMFISCLCKVGKSEEAIPLIPEMLNTGIVPSVVNFRTVFYGLNREGKQD 874 Query: 181 LAQVV 195 LA+ V Sbjct: 875 LARNV 879 >ref|XP_002524089.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223536657|gb|EEF38299.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1072 Score = 103 bits (257), Expect = 2e-20 Identities = 47/64 (73%), Positives = 54/64 (84%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGP PDFKTYSMFI CLCK GKSEEA +L+S ML DGI+PSTINFRT+ +GLN EGK +L Sbjct: 994 KGPKPDFKTYSMFISCLCKAGKSEEALQLLSRMLEDGIVPSTINFRTVFFGLNCEGKNDL 1053 Query: 184 AQVV 195 A+ V Sbjct: 1054 ARTV 1057 >gb|EPS63838.1| hypothetical protein M569_10945, partial [Genlisea aurea] Length = 913 Score = 103 bits (256), Expect = 3e-20 Identities = 48/65 (73%), Positives = 54/65 (83%) Frame = +1 Query: 1 QKGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPN 180 Q GP PDFKTYSMFI+CLCK G SE+A KLI EM+ DG+ PSTINFR II+GLNRE KP Sbjct: 836 QNGPLPDFKTYSMFIECLCKTGNSEDALKLIDEMVEDGMSPSTINFREIIWGLNREDKPE 895 Query: 181 LAQVV 195 LA+VV Sbjct: 896 LAKVV 900 >ref|XP_006286714.1| hypothetical protein CARUB_v10002874mg [Capsella rubella] gi|482555420|gb|EOA19612.1| hypothetical protein CARUB_v10002874mg [Capsella rubella] Length = 1016 Score = 103 bits (256), Expect = 3e-20 Identities = 47/65 (72%), Positives = 56/65 (86%) Frame = +1 Query: 1 QKGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPN 180 +KG SPDFKTYS FI+CLC+ GKSE+A KL+SEML GI PSTINFRT+ YGLNREGK + Sbjct: 937 EKGTSPDFKTYSKFINCLCQAGKSEDALKLLSEMLDKGIAPSTINFRTVFYGLNREGKQD 996 Query: 181 LAQVV 195 LA++V Sbjct: 997 LARIV 1001 >ref|XP_002871218.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317055|gb|EFH47477.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1029 Score = 103 bits (256), Expect = 3e-20 Identities = 47/65 (72%), Positives = 56/65 (86%) Frame = +1 Query: 1 QKGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPN 180 +KG SPDFKTYS FI+CLC+ GKSE+A KL+SEML GI PSTINFRT+ YGLNREGK + Sbjct: 950 EKGTSPDFKTYSKFINCLCQAGKSEDALKLLSEMLDKGIAPSTINFRTVFYGLNREGKQD 1009 Query: 181 LAQVV 195 LA++V Sbjct: 1010 LARIV 1014 >gb|EXC12963.1| hypothetical protein L484_016893 [Morus notabilis] Length = 1039 Score = 102 bits (254), Expect = 5e-20 Identities = 46/64 (71%), Positives = 55/64 (85%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGP PDF+TYSMFI CLC VGKSEEA +LI EML+ GI+PST+NFRT+ +GLNREGK +L Sbjct: 961 KGPLPDFRTYSMFISCLCNVGKSEEAVRLIDEMLNSGIVPSTVNFRTVFHGLNREGKQSL 1020 Query: 184 AQVV 195 A+ V Sbjct: 1021 ARSV 1024 >ref|XP_002308333.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550336797|gb|EEE91856.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 1048 Score = 102 bits (253), Expect = 7e-20 Identities = 43/64 (67%), Positives = 56/64 (87%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGP+PDFKTYSMF+ CLC+ GKSEEA +L+S+M+ +GI+PS +NFRT+ +GLNREGK +L Sbjct: 971 KGPAPDFKTYSMFLSCLCRAGKSEEALQLLSDMVDNGIVPSNVNFRTVFFGLNREGKQSL 1030 Query: 184 AQVV 195 AQ V Sbjct: 1031 AQTV 1034 >ref|XP_002333469.1| predicted protein [Populus trichocarpa] Length = 1048 Score = 102 bits (253), Expect = 7e-20 Identities = 43/64 (67%), Positives = 56/64 (87%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGP+PDFKTYSMF+ CLC+ GKSEEA +L+S+M+ +GI+PS +NFRT+ +GLNREGK +L Sbjct: 971 KGPAPDFKTYSMFLSCLCRAGKSEEALQLLSDMVDNGIVPSNVNFRTVFFGLNREGKQSL 1030 Query: 184 AQVV 195 AQ V Sbjct: 1031 AQTV 1034 >ref|XP_006481630.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial-like [Citrus sinensis] Length = 1040 Score = 101 bits (251), Expect = 1e-19 Identities = 47/64 (73%), Positives = 54/64 (84%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGP PDF+TYSMFI CLCKVGKSEEA +L+SEM GI+PS INFRTI +GLNREGK +L Sbjct: 962 KGPFPDFRTYSMFIGCLCKVGKSEEALQLLSEMTESGIVPSNINFRTIFFGLNREGKRDL 1021 Query: 184 AQVV 195 A+ V Sbjct: 1022 ARSV 1025 >ref|XP_006430030.1| hypothetical protein CICLE_v10010964mg [Citrus clementina] gi|557532087|gb|ESR43270.1| hypothetical protein CICLE_v10010964mg [Citrus clementina] Length = 1040 Score = 101 bits (251), Expect = 1e-19 Identities = 47/64 (73%), Positives = 54/64 (84%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGP PDF+TYSMFI CLCKVGKSEEA +L+SEM GI+PS INFRTI +GLNREGK +L Sbjct: 962 KGPFPDFRTYSMFIGCLCKVGKSEEALELLSEMTESGIVPSNINFRTIFFGLNREGKRDL 1021 Query: 184 AQVV 195 A+ V Sbjct: 1022 ARSV 1025 >ref|XP_006399113.1| hypothetical protein EUTSA_v10012543mg [Eutrema salsugineum] gi|557100203|gb|ESQ40566.1| hypothetical protein EUTSA_v10012543mg [Eutrema salsugineum] Length = 1036 Score = 99.8 bits (247), Expect = 3e-19 Identities = 44/65 (67%), Positives = 55/65 (84%) Frame = +1 Query: 1 QKGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPN 180 +KG SPDF+TYS FI+CLC+ GKSE+A L+SEML GI PST+NFRT+ YGLNREGK + Sbjct: 957 EKGTSPDFRTYSKFINCLCQAGKSEDALNLLSEMLDKGIAPSTVNFRTVFYGLNREGKQD 1016 Query: 181 LAQVV 195 LA++V Sbjct: 1017 LARIV 1021 >ref|XP_006826424.1| hypothetical protein AMTR_s00004p00162290 [Amborella trichopoda] gi|548830738|gb|ERM93661.1| hypothetical protein AMTR_s00004p00162290 [Amborella trichopoda] Length = 961 Score = 99.8 bits (247), Expect = 3e-19 Identities = 45/64 (70%), Positives = 54/64 (84%) Frame = +1 Query: 4 KGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPNL 183 KGP PDF+TYSMFI CLC+ G+SEEA +LI +M+ DGIIPST+NFRT+ YGLNREGK +L Sbjct: 883 KGPFPDFETYSMFISCLCRDGRSEEALQLIYDMMEDGIIPSTLNFRTVYYGLNREGKHDL 942 Query: 184 AQVV 195 A V Sbjct: 943 AHTV 946 >ref|XP_006348568.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial-like [Solanum tuberosum] Length = 1087 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/65 (67%), Positives = 54/65 (83%) Frame = +1 Query: 1 QKGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPN 180 + GP PDFK YSMFI CLC++G SEEA +LISEML GI+PST+N+RT+ YGLNREGK + Sbjct: 1008 KNGPYPDFKAYSMFISCLCRIGYSEEALQLISEMLDVGIVPSTVNYRTVFYGLNREGKQD 1067 Query: 181 LAQVV 195 LA+ V Sbjct: 1068 LAKTV 1072 >ref|XP_004228915.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial-like [Solanum lycopersicum] Length = 1092 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/65 (67%), Positives = 54/65 (83%) Frame = +1 Query: 1 QKGPSPDFKTYSMFIDCLCKVGKSEEAFKLISEMLHDGIIPSTINFRTIIYGLNREGKPN 180 + GP PDF YSMFI CLC++G SEEA +LISEML+ GIIPST+N+RT+ YGLNREGK + Sbjct: 1013 KNGPYPDFNAYSMFISCLCRIGNSEEALQLISEMLNIGIIPSTVNYRTVFYGLNREGKQD 1072 Query: 181 LAQVV 195 LA+ V Sbjct: 1073 LAKTV 1077