BLASTX nr result
ID: Rehmannia22_contig00034257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00034257 (581 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ06283.1| hypothetical protein PRUPE_ppa014390mg [Prunus pe... 73 6e-11 gb|EOY04446.1| Uncharacterized protein isoform 3, partial [Theob... 66 7e-09 gb|EOY04445.1| Uncharacterized protein isoform 2 [Theobroma cacao] 66 7e-09 gb|EOY04444.1| Uncharacterized protein isoform 1 [Theobroma cacao] 66 7e-09 ref|XP_006429592.1| hypothetical protein CICLE_v10013263mg [Citr... 63 6e-08 >gb|EMJ06283.1| hypothetical protein PRUPE_ppa014390mg [Prunus persica] Length = 71 Score = 72.8 bits (177), Expect = 6e-11 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = +2 Query: 206 DSPYDDPLMGXXXXXXLLISSIFRMIGRCVFVACYPVLQCFGLDECR 346 DSPYDDPL+ L+SS FR IGRC+F AC+P+LQCFGLD CR Sbjct: 13 DSPYDDPLLSCCCCPCYLVSSTFRRIGRCIFAACFPLLQCFGLDNCR 59 >gb|EOY04446.1| Uncharacterized protein isoform 3, partial [Theobroma cacao] Length = 62 Score = 65.9 bits (159), Expect = 7e-09 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 206 DSPYDDPLMGXXXXXXLLISSIFRMIGRCVFVACYPVLQCFGLDE 340 DSPYDDP + ++SSIFR +GRC+FVACYPVL CFG D+ Sbjct: 4 DSPYDDPFLRCCCCPCFIMSSIFRGLGRCIFVACYPVLHCFGFDD 48 >gb|EOY04445.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 72 Score = 65.9 bits (159), Expect = 7e-09 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 206 DSPYDDPLMGXXXXXXLLISSIFRMIGRCVFVACYPVLQCFGLDE 340 DSPYDDP + ++SSIFR +GRC+FVACYPVL CFG D+ Sbjct: 14 DSPYDDPFLRCCCCPCFIMSSIFRGLGRCIFVACYPVLHCFGFDD 58 >gb|EOY04444.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 71 Score = 65.9 bits (159), Expect = 7e-09 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 206 DSPYDDPLMGXXXXXXLLISSIFRMIGRCVFVACYPVLQCFGLDE 340 DSPYDDP + ++SSIFR +GRC+FVACYPVL CFG D+ Sbjct: 14 DSPYDDPFLRCCCCPCFIMSSIFRGLGRCIFVACYPVLHCFGFDD 58 >ref|XP_006429592.1| hypothetical protein CICLE_v10013263mg [Citrus clementina] gi|557531649|gb|ESR42832.1| hypothetical protein CICLE_v10013263mg [Citrus clementina] Length = 73 Score = 62.8 bits (151), Expect = 6e-08 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 206 DSPYDDPLMGXXXXXXLLISSIFRMIGRCVFVACYPVLQCFGLDE 340 DSPYDDP + ++SSIF I RC+FVACYP+L+CFGLD+ Sbjct: 16 DSPYDDPFLRCCCCPCFMVSSIFTGIRRCIFVACYPLLRCFGLDD 60